PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G065300.1
Common NameB456_008G065300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 196aa    MW: 22361.2 Da    PI: 7.7083
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G065300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.75.3e-1361119563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         ++ +r+ +NRe+ArrsR RK++ ++ L   v  L++ N +    ++  +++++++++e+
  Gorai.008G065300.1  61 RKRKRMLSNRESARRSRMRKQKHLDDLMAQVSDLTNHNNQILTSINVTTQLYSNVEAEN 119
                         57899*************************************99999999999888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.7E-1056136No hitNo description
SMARTSM003388.4E-1857121IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.1459122IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.88E-1261112No hitNo description
PfamPF001703.4E-1061116IPR004827Basic-leucine zipper domain
CDDcd147022.47E-1962113No hitNo description
PROSITE patternPS0003606479IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MSPVLSEILL SGFMINSTLR RRTHLVQSFS VVFLYCGASS GSSTLRSSSS SEDFQPILDE  60
RKRKRMLSNR ESARRSRMRK QKHLDDLMAQ VSDLTNHNNQ ILTSINVTTQ LYSNVEAENL  120
VLRAQMTELS NRLQSLNEII HFINSSNGVL QNDTNFDQPA YCHPHHQLND DSLMNPWNFS  180
TTNQPFMPSA DMMMY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16081RKRKRMLSNRESARRSRMRKQK
27380RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436848.11e-115PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A0D2TYH21e-143A0A0D2TYH2_G
STRINGPOPTR_0004s16560.14e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.17e-43basic leucine-zipper 44
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]