PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G063600.4
Common NameB456_008G063600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 313aa    MW: 36007.2 Da    PI: 5.0979
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G063600.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM109.83e-34128853129
                 NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +e+kewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v+++k++l+g++ktLvfykgrap+g+ktdW+mheyrle
  Gorai.008G063600.4  12 EEQKEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYDNKSKLIGMRKTLVFYKGRAPNGHKTDWIMHEYRLE 88 
                         5678***********************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100540.4641108IPR003441NAC domain
SuperFamilySSF1019417.98E-3711108IPR003441NAC domain
PfamPF023652.4E-151687IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MDPPERCRIG YEEQKEWYFF SHKDKKYPTG TRTNRATMAG FWKATGRDKA VYDNKSKLIG  60
MRKTLVFYKG RAPNGHKTDW IMHEYRLESD DNRPPQEEGW VICRAFKKKI SGQAKSIEGW  120
ESRCFYDEPS GLSSVIDPME YLSKQPHKFL PYCKEETEAD NLDFVYCDQF VELPQLESPS  180
LPLINKPASI SLISENIVNY GEEEEEEADK KRMCNANTKK VTDWRALDKF VASQLSHEDR  240
YNNGDQERAS ISSFDANNSS NSDMEALLLL QSSREERNKL KELLNSSTSH CDVGICIFDQ  300
LKGDDQEALS LN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-301411370170NO APICAL MERISTEM PROTEIN
1ut4_B8e-301411370170NO APICAL MERISTEM PROTEIN
1ut7_A8e-301411370170NO APICAL MERISTEM PROTEIN
1ut7_B8e-301411370170NO APICAL MERISTEM PROTEIN
3swm_A9e-301411373173NAC domain-containing protein 19
3swm_B9e-301411373173NAC domain-containing protein 19
3swm_C9e-301411373173NAC domain-containing protein 19
3swm_D9e-301411373173NAC domain-containing protein 19
3swp_A9e-301411373173NAC domain-containing protein 19
3swp_B9e-301411373173NAC domain-containing protein 19
3swp_C9e-301411373173NAC domain-containing protein 19
3swp_D9e-301411373173NAC domain-containing protein 19
4dul_A8e-301411370170NAC domain-containing protein 19
4dul_B8e-301411370170NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Expressed in root metaxylem pole and in shoot pre-procambium and procambium (PubMed:18445131). Present in root developing xylems (PubMed:16103214). Specifically expressed in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472200.0KC847220.1 Gossypium hirsutum NAC domain protein NAC43 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436810.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_012436811.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_012436812.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_012436813.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9SL411e-113NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A0D2RAL90.0A0A0D2RAL9_GOSRA; Uncharacterized protein
STRINGGorai.008G063600.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-100vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  4. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]