PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G063600.3
Common NameB456_008G063600, LOC105763229
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 361aa    MW: 41704.7 Da    PI: 4.9843
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G063600.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.63.9e-5661361129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++     ++e+kewyfFs++dkky+tg+r+nrat +g+Wkatg+
  Gorai.008G063600.3   6 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVITDIDLYRIEPWDLQErcrIGYEEQKEWYFFSHKDKKYPTGTRTNRATMAGFWKATGR 95 
                         69****************************.9***************953432234677******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk+v+++k++l+g++ktLvfykgrap+g+ktdW+mheyrle
  Gorai.008G063600.3  96 DKAVYDNKSKLIGMRKTLVFYKGRAPNGHKTDWIMHEYRLE 136
                         ***************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-603156IPR003441NAC domain
PROSITE profilePS5100559.7296156IPR003441NAC domain
PfamPF023659.2E-297135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MMESSVPPGF RFHPTDEELV GYYLRKKVAS QKIDLDVITD IDLYRIEPWD LQERCRIGYE  60
EQKEWYFFSH KDKKYPTGTR TNRATMAGFW KATGRDKAVY DNKSKLIGMR KTLVFYKGRA  120
PNGHKTDWIM HEYRLESDDN RPPQEEGWVI CRAFKKKISG QAKSIEGWES RCFYDEPSGL  180
SSVIDPMEYL SKQPHKFLPY CKEETEADNL DFVYCDQFVE LPQLESPSLP LINKPASISL  240
ISENIVNYGE EEEEEADKKR MCNANTKKVT DWRALDKFVA SQLSHEDRYN NGDQERASIS  300
SFDANNSSNS DMEALLLLQS SREERNKLKE LLNSSTSHCD VGICIFDQLK GDDQEALSLN  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-50315712169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Expressed in root metaxylem pole and in shoot pre-procambium and procambium (PubMed:18445131). Present in root developing xylems (PubMed:16103214). Specifically expressed in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472200.0KC847220.1 Gossypium hirsutum NAC domain protein NAC43 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436810.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_012436811.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_012436812.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_012436813.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9SL411e-151NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A0D2PPU50.0A0A0D2PPU5_GOSRA; Uncharacterized protein
STRINGGorai.008G063600.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-139vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  4. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]