PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G059900.1
Common NameB456_008G059900, LOC105763186
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CO-like
Protein Properties Length: 375aa    MW: 41500.4 Da    PI: 5.9685
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G059900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.25.3e-061757438
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                        r+C+++ +   + +C+ ++ +lC+ C    H        H+
  Gorai.008G059900.1 17 RICDTCRSAACTVYCRADSAYLCAGCDARVHAAnrvasrHE 57
                        79******99*****************99995555666665 PP

2zf-B_box30.48.2e-1059104342
            zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                          ++C+ +e+ ++ l C+ +   lC +C  e+H+       H++vp+
  Gorai.008G059900.1  59 VWVCEVCERAPAALLCKADAASLCTTCDAEIHSAnplarrHQRVPI 104
                         689*****************************66899999**9997 PP

3CCT69.39.8e-24307350144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae RpR+KGrF+k++
  Gorai.008G059900.1 307 REARVLRYREKKKTRKFEKTIRYASRKAYAEMRPRIKGRFAKRT 350
                         9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.4E-81461IPR000315B-box-type zinc finger
PROSITE profilePS5011910.3951461IPR000315B-box-type zinc finger
CDDcd000214.43E-81761No hitNo description
PROSITE profilePS5011911.3257104IPR000315B-box-type zinc finger
PfamPF006438.6E-858104IPR000315B-box-type zinc finger
CDDcd000219.48E-960104No hitNo description
SMARTSM003363.6E-1162104IPR000315B-box-type zinc finger
PROSITE profilePS5101716.519307349IPR010402CCT domain
PfamPF062032.1E-17307349IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MLKEEISDAG GGNDWARICD TCRSAACTVY CRADSAYLCA GCDARVHAAN RVASRHERVW  60
VCEVCERAPA ALLCKADAAS LCTTCDAEIH SANPLARRHQ RVPILPISGC LYDPLPTDHG  120
CRKMASATET EDGFMCTNGD ETIAEDEDEA ASWLLLNPGK NSTNQNNGFM LAGEVDDYLD  180
LVEYNSSVEN QFTDQHQQQH YGVPHKSYGG DSVVPVQSGE AKDHFQQQQQ QHQNFQYGLD  240
YDASKAAYSY NGSITRTVSL SSVDVGIVPE STMSDISISH PRPPKGTIDL FSGPPTQMPT  300
QLAPMEREAR VLRYREKKKT RKFEKTIRYA SRKAYAEMRP RIKGRFAKRT DVEVEVDQMF  360
STTVITGYGI VPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM2017010.0KM201701.1 Gossypium barbadense var. brasiliense CONSTANS-like 1 protein gene, complete cds.
GenBankKM2016990.0KM201699.1 Gossypium barbadense var. peruvianum CONSTANS-like 1 protein gene, complete cds.
GenBankKM2016970.0KM201697.1 Gossypium barbadense var. peruvianum CONSTANS-like 1 protein gene, complete cds.
GenBankKM2016870.0KM201687.1 Gossypium barbadense cultivar Pima-1 CONSTANS-like 1 protein gene, complete cds.
GenBankKM2016790.0KM201679.1 Gossypium hirsutum var. marie-galante CONSTANS-like 1 protein gene, complete cds.
GenBankKM2016690.0KM201669.1 Gossypium hirsutum cultivar JM CONSTANS-like 1 protein gene, complete cds.
GenBankKM2016670.0KM201667.1 Gossypium hirsutum cultivar SM3 CONSTANS-like 1 protein gene, complete cds.
GenBankKM2016650.0KM201665.1 Gossypium hirsutum cultivar ZMS12 CONSTANS-like 1 protein gene, complete cds.
GenBankKM2016630.0KM201663.1 Gossypium hirsutum cultivar acc. TM-1 CONSTANS-like 1 protein gene, complete cds.
GenBankKM2016610.0KM201661.1 Gossypium raimondii CONSTANS-like 1 protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436773.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-157COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLA0A0D2T1760.0A0A0D2T176_G
TrEMBLA0A0D3R1Q60.0A0A0D3R1Q6_G
TrEMBLA0A0D3R2I90.0A0A0D3R2I9_G
STRINGPOPTR_0017s14410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-123CONSTANS-like 2
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Zhang R, et al.
    Molecular evolution and phylogenetic analysis of eight COL superfamily genes in group I related to photoperiodic regulation of flowering time in wild and domesticated cotton (Gossypium) species.
    PLoS ONE, 2015. 10(2): p. e0118669
    [PMID:25710777]