PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G024700.3
Common NameB456_008G024700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 397aa    MW: 42735.8 Da    PI: 10.0146
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G024700.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.85.4e-14347390548
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                         +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L+k+
  Gorai.008G024700.3 347 RRQRRMIKNRESAARSRARKQAYTLELEAEVAKLKEINEELQKK 390
                         79*************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-8343394IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.565345390IPR004827Basic-leucine zipper domain
CDDcd147074.34E-25347392No hitNo description
SuperFamilySSF579598.44E-10347390No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-13347390No hitNo description
PfamPF001706.0E-12347390IPR004827Basic-leucine zipper domain
PROSITE patternPS000360350365IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MGSHLNFKNF GDAPSMEGNE SKPLGNFPLT RQSSIYSLTF DELQNTFSGI GKDFGSMNMD  60
ELLKNISTAE ETQAFMTATV PGGEGSLSGG NLQRQGSLTL PRTLSQKTVD EVWRNLMKEN  120
DGAKDGSSGG GGGGGANLPQ RQRTLGEMTL EEFLVKAGVV REDMQQFGVP NNTGFFGNNN  180
SGVALGFQQI NRNNGFLSNN NSVLSQPPRL PQNMTGTKSS QPQQQQQQQQ QPPQQQQQPQ  240
ARPLFPKQQT VAFAPSMHLM NTTQLASPGG RSSMVGIGDP SMNSNIVQSS GLQSGGMGIV  300
GIGSPGSQIS SDVISKNSVD TSSLSPVPYV FGRGRKCSAA LEKVVERRQR RMIKNRESAA  360
RSRARKQAYT LELEAEVAKL KEINEELQKK QVSTVC*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00038PBMTransfer from AT4G34000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5274841e-118HQ527484.1 Gossypium herbaceum clone NBRI_E_EYT27PB03G3LVN simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436192.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
SwissprotQ9M7Q31e-108AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLA0A0D2TVM10.0A0A0D2TVM1_G
STRINGVIT_03s0063g00310.t011e-148(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.16e-84abscisic acid responsive element-binding factor 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]