PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G014700.2
Common NameB456_008G014700, LOC105762712
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 198aa    MW: 22675.3 Da    PI: 4.6788
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G014700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM123.91.3e-3891271128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF Ptdeelvv++L++k++  +++  +vi+++++y ++Pw+L+ k+ +e ++wyf+s+r +        +r+t +gyWk  g +++
  Gorai.008G014700.2   9 LPPGFRFCPTDEELVVHFLQRKAALLPCHP-DVIPDLELYPHDPWELDGKALGEGNQWYFYSRRTQ--------KRITGNGYWKPMGIEED 90 
                         79*************************999.99**************977778899******9865........699************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v+++++++vg+kk Lvfy g+ p + kt+W+m+eyrl
  Gorai.008G014700.2  91 VINSRSKKVGMKKYLVFYIGEGPAAIKTNWIMQEYRL 127
                         ***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-486157IPR003441NAC domain
PROSITE profilePS5100544.9479158IPR003441NAC domain
PfamPF023652.8E-2310127IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MGENSSVNLP PGFRFCPTDE ELVVHFLQRK AALLPCHPDV IPDLELYPHD PWELDGKALG  60
EGNQWYFYSR RTQKRITGNG YWKPMGIEED VINSRSKKVG MKKYLVFYIG EGPAAIKTNW  120
IMQEYRLSKS DSSSTKSSKR RGHSKDYSKW VVCRVYERNC SEDEDDGDDD DDGTQLSCLD  180
EVFLSLDDMD EISLPFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-41516413171NO APICAL MERISTEM PROTEIN
1ut4_B1e-41516413171NO APICAL MERISTEM PROTEIN
1ut7_A1e-41516413171NO APICAL MERISTEM PROTEIN
1ut7_B1e-41516413171NO APICAL MERISTEM PROTEIN
3swm_A1e-41516416174NAC domain-containing protein 19
3swm_B1e-41516416174NAC domain-containing protein 19
3swm_C1e-41516416174NAC domain-containing protein 19
3swm_D1e-41516416174NAC domain-containing protein 19
3swp_A1e-41516416174NAC domain-containing protein 19
3swp_B1e-41516416174NAC domain-containing protein 19
3swp_C1e-41516416174NAC domain-containing protein 19
3swp_D1e-41516416174NAC domain-containing protein 19
4dul_A1e-41516413171NAC domain-containing protein 19
4dul_B1e-41516413171NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in root xylem vessels (PubMed:15923329). Expressed in stems, vascular tissue of cauline leaves and tracheary elements of sepals (PubMed:18069942). {ECO:0000269|PubMed:15923329, ECO:0000269|PubMed:18069942}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472410.0KC847241.1 Gossypium hirsutum NAC domain protein NAC64 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436014.11e-146PREDICTED: NAC transcription factor 25-like isoform X2
SwissprotQ8GWK66e-86NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A0D2SSZ01e-145A0A0D2SSZ0_GOSRA; Uncharacterized protein
STRINGGorai.008G014700.11e-124(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.19e-79xylem NAC domain 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  3. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]