PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G363800.1
Common NameB456_007G363800, LOC105761685
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 315aa    MW: 34178.6 Da    PI: 9.8405
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G363800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA96.43.2e-30160215258
           CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          p+YVNaKQy++I++RRq+Rak+  ++kl +k+rkpy+h SRh hA+rRpRg+gGrF
  Gorai.007G363800.1 160 GPIYVNAKQYKGIMRRRQSRAKAVLQNKL-SKARKPYMHYSRHLHAMRRPRGCGGRF 215
                         69***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-34157218IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.469158218IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.4E-21161183IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.9E-26161215IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.4E-21192215IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MQTLHLKEYG GIGNHPMGQL ASIPPSSLPT LPWCSVLGSH QSLHGGEAFG AQLKPFLMEH  60
PSNGDQVLSS KQLNKGNTAQ FTIFPGDCKN SGDEHNKPQA VTSLQSDPAE NGARFELGFG  120
QHMASAKYPY MDQLYGVFST YGAQISGRVM LPLNMASEEG PIYVNAKQYK GIMRRRQSRA  180
KAVLQNKLSK ARKPYMHYSR HLHAMRRPRG CGGRFLNTRG SGSDKDDTAT KKATQGLISN  240
RSCSSDSGTL NSSKGPTHSG CSEVTSIYSR RDLDHHFLID HLGLSVHSIS SMINNQRGGT  300
ITVATADNCC NLKV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A2e-16159216260HAPB protein
4g92_A2e-16159216260HAPB protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5836293e-46JX583629.1 Gossypium hirsutum clone NBRI_GE16721 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012435019.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
TrEMBLA0A0D2TSD80.0A0A0D2TSD8_GOSRA; Uncharacterized protein
STRINGGorai.007G363800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30082767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.28e-50nuclear factor Y, subunit A10
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]