PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G363700.1
Common NameB456_007G363700, LOC105801660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 324aa    MW: 35844.6 Da    PI: 6.2358
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G363700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.56.1e-171152344
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                        i+n+s r+v++ kRr g++KK +EL +LC++++++ii+s++ 
  Gorai.007G363700.1 11 ISNDSARKVSLEKRRLGLMKKMNELTTLCGIRACLIIYSPNE 52
                        9**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.4E-23160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.61151IPR002100Transcription factor, MADS-box
CDDcd002667.85E-27285No hitNo description
SuperFamilySSF554555.62E-22295IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-6323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-151152IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-62338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MTRKKVTLAW ISNDSARKVS LEKRRLGLMK KMNELTTLCG IRACLIIYSP NESEPMVWPS  60
HAEVQLQLEE YWKTSELDRL KKMVNQETYL KERITKAKEQ LGKLQRKNNE VEMGHLMHQI  120
EQGKGIDEFN NGELHGLIRL VEEKMDEIKK RIEFFHQLPH GDLTAQTVGG GHKPLMMNQR  180
FTNMVNNNEH TFGDIVAQDH LGLLPGHKLG GNSDVGVPLY GDLRGTTTDM GQQLLGFRPY  240
GDGATEMGLP HGSTIGSNNI FGAFGNDIGM GGHPFECIGS SYNVSEQGVA WPLGGDGGEN  300
CGGTSNGIDM QFDGQSWPDN FSA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488326.10.0PREDICTED: MADS-box transcription factor PHERES 1-like
TrEMBLA0A0D2SQC20.0A0A0D2SQC2_GOSRA; Uncharacterized protein
STRINGGorai.007G363700.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-35AGAMOUS-like 80
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]