PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G325700.1
Common NameB456_007G325700, LOC105801639
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 281aa    MW: 31510.3 Da    PI: 5.2171
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G325700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.41.1e-11151199553
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                         kr +r   NR +A+rsR RK+++i eLe+ v +L++e ++L  ++  l 
  Gorai.007G325700.1 151 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSTLSPRVAFLD 199
                         899***********************************99987776555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.4E-15147211IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.875149212IPR004827Basic-leucine zipper domain
PfamPF001703.2E-10151195IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.1E-14151203No hitNo description
SuperFamilySSF579595.63E-12151205No hitNo description
CDDcd147031.78E-22152202No hitNo description
PROSITE patternPS000360154169IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MPTMANFISS STTSTMMKDS NHQPSWADEF LDFSSMRRGA KRRSMSDFIA FLDQPLEEEN  60
RAGNAMMMEP NMFDRLDDEQ LKSMFSDDVS LTLPATTMGS SSSTPLMSDQ NSNNDEKPTP  120
GEVESSYKLN ETQASEPPST SNGGDPITDP KRVKRILANR QSAQRSRVRK LQYISELERS  180
VTTLQTEVST LSPRVAFLDH QRVVLTVENS ALKQRIAALA QDKIFKDAHQ EALKKEIERL  240
TQVYQQQQSL KNMNDNHPPP PPQQQQPLLP PPPNEGQLIS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488308.10.0PREDICTED: basic leucine zipper 34-like
SwissprotQ9M2K42e-81BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A0D2TQI10.0A0A0D2TQI1_G
STRINGVIT_19s0014g01780.t012e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-82bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]