PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G277300.2
Common NameB456_007G277300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 354aa    MW: 38371.4 Da    PI: 5.9621
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G277300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.53.8e-15155210358
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                         ++kr rr+ +NRe+ArrsR+RK+a + eLe  v +L  eN  L k l  +++ + +
  Gorai.007G277300.2 155 DVKRVRRMLSNRESARRSRRRKQAHLTELESQVSQLRVENANLLKSLTDISQRYNE 210
                         78******************************************999988887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.5E-17153217IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.346155210IPR004827Basic-leucine zipper domain
PfamPF001705.9E-13156208IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.61E-11157206No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-11157209No hitNo description
PROSITE patternPS000360160175IPR004827Basic-leucine zipper domain
PfamPF124982.9E-33224348IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MDRVFSVEEV PDHFWSSSAA DGGDDDKNKS PSSEMNRSAS EWAFQQFLRE EKLNLACAAV  60
AMSMASFAKP QDSAARADSG PQASNTPQLG SKTVSRGAGD KDDNAVAEVP SFPSGQKKLR  120
AQVRPSTSTG SSKEQSDEDE VEGENETMEN MDPADVKRVR RMLSNRESAR RSRRRKQAHL  180
TELESQVSQL RVENANLLKS LTDISQRYNE AAVNNRILKA DVETLKAKVK MAVEAVKRTT  240
GLNPVFHALP EIPSMSSFDG CPSDTSTDAA VYEEDGPKHT LYQAAANDSI STHELRINNA  300
LADISSVENI QPVSEGSAVT GNKIGRTASL QRVASLEHLQ KRIHGGVSLN GKQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169176RRSRRRKQ
2171176SRRRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00040PBMTransfer from AT5G28770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012492794.10.0PREDICTED: light-inducible protein CPRF2-like isoform X2
SwissprotQ990901e-108CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLA0A0D2R0F60.0A0A0D2R0F6_G
STRINGPOPTR_0013s03800.11e-126(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.23e-62bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]