PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G267700.1
Common NameB456_007G267700, LOC105804535
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 350aa    MW: 39481.4 Da    PI: 7.1887
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G267700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM184.62.4e-57171441129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdee++++yL++kv ++++++ ++i evd++k+ePwdLpkk+k +ek+wyfF++rd+ky+tg r+nrat++gyWkatgkdke
  Gorai.007G267700.1  17 LPPGFRFHPTDEEIITHYLTEKVMNSNFSA-SAIGEVDLNKCEPWDLPKKAKMGEKQWYFFCQRDRKYPTGMRTNRATEAGYWKATGKDKE 106
                         79**************************99.88***************99999************************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +++ kg lvg+kktLvfykgrapkgek++Wvmheyrle
  Gorai.007G267700.1 107 IFKGKGCLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 144
                         ***9********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6315168IPR003441NAC domain
PROSITE profilePS5100559.99917168IPR003441NAC domain
PfamPF023657.9E-3018143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MEEAIVVNKG DDELIDLPPG FRFHPTDEEI ITHYLTEKVM NSNFSASAIG EVDLNKCEPW  60
DLPKKAKMGE KQWYFFCQRD RKYPTGMRTN RATEAGYWKA TGKDKEIFKG KGCLVGMKKT  120
LVFYKGRAPK GEKSNWVMHE YRLEGKFSYY NLPKGAKDEW VVCRVFDKNN TGTKKSPIPD  180
HHQLLRMNSY GDDFMDYASL PPLMDPTYNS NKPGSSCTFM DGGDNEFKAA INNQTFLQVP  240
PNHPYGSSNI FNPQIPIQNP IVFHQATPTS TYVHQGRTTA GTGFAGNDPA NRQCKVEQFS  300
SNQSMVSLSQ DTGLSTEINN NEISSVVSKN DMGFGISKSF EDLRCLWDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-541517418174NAC domain-containing protein 19
3swm_B5e-541517418174NAC domain-containing protein 19
3swm_C5e-541517418174NAC domain-containing protein 19
3swm_D5e-541517418174NAC domain-containing protein 19
3swp_A5e-541517418174NAC domain-containing protein 19
3swp_B5e-541517418174NAC domain-containing protein 19
3swp_C5e-541517418174NAC domain-containing protein 19
3swp_D5e-541517418174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9141390.0JQ914139.1 Gossypium hirsutum NAC domain protein 8 (NAC8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001314645.10.0NAC domain-containing protein 92-like
RefseqXP_012492652.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FK441e-124NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A0D2SKF90.0A0A0D2SKF9_GOSRA; Uncharacterized protein
TrEMBLU5IJP40.0U5IJP4_GOSHI; NAC domain protein 8
STRINGGorai.007G267700.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22692775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.11e-126Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]