PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G210500.1
Common NameB456_007G210500, LOC105803888
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 308aa    MW: 33609.6 Da    PI: 7.0625
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G210500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.89.1e-4471061100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC+++Cv+apyfp ++p+kfanvhk+FGasnv kll++l+ ++reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q++
  Gorai.007G210500.1   7 PCAACKFLRRKCTQECVFAPYFPPDNPQKFANVHKVFGASNVAKLLNELNASQREDAVNSLAYEAEARLRDPVYGCVGLISILQHKLKQMQ 97 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++l+ +k+e
  Gorai.007G210500.1  98 HDLNNAKKE 106
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0786107IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DNPQKFANVH KVFGASNVAK LLNELNASQR  60
EDAVNSLAYE AEARLRDPVY GCVGLISILQ HKLKQMQHDL NNAKKELATY IGPQAMLPIL  120
QPHVFLQQHV GNASSAVMQH NMMPMMGIPT AAAASASHGG QLVIREPPQQ QAQIFEAQQQ  180
LVAAVAAREQ QEMFRGYEHQ HQHQQGQQQH EIVRFNGGGF EGGGSVTATG FNQITPGSSM  240
SSSLALGSFD NPYQIQTQPQ QQHGSHSLQP HLLLQTQEGQ PQEHPQSQQN QPQMSGSEEG  300
RSIGPSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491765.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ34e-98LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0D2TIW80.0A0A0D2TIW8_G
STRINGPOPTR_0007s11460.11e-111(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-83ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]