PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G197900.2
Common NameB456_007G197900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 347aa    MW: 38104.5 Da    PI: 5.6846
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G197900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.42.2e-19262296135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         Cs+Cg+tkTp+WR gp g ktLCnaCG+++++ +l
  Gorai.007G197900.2 262 CSHCGVTKTPQWRAGPMGAKTLCNACGVRFKSGRL 296
                         *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.0E-901339IPR016679Transcription factor, GATA, plant
SMARTSM004013.8E-18256310IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.229256292IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.23E-14258319No hitNo description
Gene3DG3DSA:3.30.50.105.8E-15260294IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.40E-14261309No hitNo description
PROSITE patternPS003440262287IPR000679Zinc finger, GATA-type
PfamPF003203.2E-17262296IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MECVEAALKT SFRKEMALKP SPQAFLEDIW VVNGQNGVSC DDFSVDDLFD FSNEEGFLQQ  60
KREDEEDEEE EEVPASSSLP KRQKLSQDNA HFSNDSTTNF DYGSLSTNEL AVPADDVENL  120
EWLSHFVEDS FLEHSTVYPT GTLMEKPKLL DGKFPEPEKS VTTTACFETP VPAKARSKRV  180
RTGGRVWSLV ATPSLTESSS SSTSSSSSSS PSPWMFCPNS GSGSIFELSE PLSVEKPPVK  240
KHKKRPSTDT TGCNGTQPTR RCSHCGVTKT PQWRAGPMGA KTLCNACGVR FKSGRLLPEY  300
RPACSPTFSS ELHSNHHRKV LEMRRKKETL GQAEPGLTPP VVPSFG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1238245VKKHKKRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487835.10.0PREDICTED: GATA transcription factor 5-like, partial
SwissprotQ9FH572e-98GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A0D2TI860.0A0A0D2TI86_G
STRINGPOPTR_0005s11960.11e-110(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.27e-92GATA transcription factor 5
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]