PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G196400.2
Common NameB456_007G196400, LOC105803734
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 355aa    MW: 40823.7 Da    PI: 4.9302
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G196400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.77.4e-56121411129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++  ++   e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+
  Gorai.007G196400.2  12 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQErcRIGYeEQSEWYFFSHKDKKYPTGTRTNRATMAGFWKATGR 101
                         69****************************.9***************953433332566******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk+v++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle
  Gorai.007G196400.2 102 DKAVYD-KSKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 141
                         ******.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-616161IPR003441NAC domain
PROSITE profilePS5100559.71112161IPR003441NAC domain
PfamPF023655.9E-2913140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MMESMESMES CVPPGFRFHP TDEELVGYYL RKKVASQKID LDVIRDIDLY RIEPWDLQER  60
CRIGYEEQSE WYFFSHKDKK YPTGTRTNRA TMAGFWKATG RDKAVYDKSK LIGMRKTLVF  120
YKGRAPNGQK TDWIMHEYRL ESDENGPPQE EGWVVCRAFK KKTTGQTKSI DVWDSSYDEP  180
SGISSVVDPL DYLSRQPQNL LPPSYLCKQE TEAENLNFVH SDQFVQLPQL ESPSLPLIKK  240
PTSISLVPEN NINNNTNHKE EEDHLLKIMC NNNNNEKVTD WRTLDKFVAS QLSHEDRYHG  300
EVAVSCFDAA DNNTNNSDMA LLLLQSSGRE EANKLNEFLN SSSDCDIGIC IFDK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-511216617170NO APICAL MERISTEM PROTEIN
1ut4_B6e-511216617170NO APICAL MERISTEM PROTEIN
1ut7_A6e-511216617170NO APICAL MERISTEM PROTEIN
1ut7_B6e-511216617170NO APICAL MERISTEM PROTEIN
3ulx_A6e-51916212169Stress-induced transcription factor NAC1
4dul_A6e-511216617170NAC domain-containing protein 19
4dul_B6e-511216617170NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Expressed in root metaxylem pole and in shoot pre-procambium and procambium (PubMed:18445131). Present in root developing xylems (PubMed:16103214). Specifically expressed in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472070.0KC847207.1 Gossypium hirsutum NAC domain protein NAC30 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491574.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_012491575.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_012491576.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9SL411e-164NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A0D2SGK40.0A0A0D2SGK4_GOSRA; Uncharacterized protein
STRINGGorai.007G196400.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-149vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  4. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]