PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G191800.3
Common NameB456_007G191800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 207aa    MW: 23171.1 Da    PI: 9.9489
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G191800.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.73.9e-16136186454
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                         ++r +r++kNRe+A rsR+RK+a++ eLe +v+ L +eN +Lk + e+l+ 
  Gorai.007G191800.3 136 DRRHKRMIKNRESAARSRARKQAYTNELELEVAHLMEENARLKRQQEQLRV 186
                         689****************************************99999975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.3E-14129185No hitNo description
SMARTSM003381.4E-13133197IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.369135185IPR004827Basic-leucine zipper domain
PfamPF001706.0E-14137185IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.25E-12137185No hitNo description
CDDcd147073.25E-29137191No hitNo description
PROSITE patternPS000360140155IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MEEVWKEINL ASLHDNSSSR EGLNPHNPHF ILQDFLARPF SKDPPANRVS ANGDTTFLVS  60
PPPPPPATLL SLNSGPGFDF LDNSYPLRSK PRLQMQNNPI SDLPNMNCPF EALASPSGLA  120
CFDKKRFQDP DNNSGDRRHK RMIKNRESAA RSRARKQAYT NELELEVAHL MEENARLKRQ  180
QEQLRVAAAT PLSGKRTLQR TSTAPF*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487828.11e-152PREDICTED: protein FD, partial
SwissprotQ84JK23e-66FD_ARATH; Protein FD
TrEMBLA0A0D2SGB41e-151A0A0D2SGB4_G
STRINGAl_scaffold_0007_4532e-66(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.14e-62bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]