PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G191800.1
Common NameB456_007G191800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 267aa    MW: 29432.9 Da    PI: 9.672
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G191800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.35.1e-16196246454
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                         ++r +r++kNRe+A rsR+RK+a++ eLe +v+ L +eN +Lk + e+l+ 
  Gorai.007G191800.1 196 DRRHKRMIKNRESAARSRARKQAYTNELELEVAHLMEENARLKRQQEQLRV 246
                         689****************************************99999975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.7E-14189245No hitNo description
SMARTSM003381.4E-13193257IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.369195245IPR004827Basic-leucine zipper domain
PfamPF001709.3E-14197245IPR004827Basic-leucine zipper domain
CDDcd147075.53E-30197251No hitNo description
SuperFamilySSF579591.0E-11197245No hitNo description
PROSITE patternPS000360200215IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MWTIFSMLGI GERRSDTCCL NTLSSVSSSS SSSSSSSSSS SSSPLSTPSH LHNQTHTPKT  60
MEEVWKEINL ASLHDNSSSR EGLNPHNPHF ILQDFLARPF SKDPPANRVS ANGDTTFLVS  120
PPPPPPATLL SLNSGPGFDF LDNSYPLRSK PRLQMQNNPI SDLPNMNCPF EALASPSGLA  180
CFDKKRFQDP DNNSGDRRHK RMIKNRESAA RSRARKQAYT NELELEVAHL MEENARLKRQ  240
QEQLRVAAAT PLSGKRTLQR TSTAPF*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5244343e-89HQ524434.1 Gossypium herbaceum clone NBRI_F034 simple sequence repeat marker, genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487828.11e-159PREDICTED: protein FD, partial
SwissprotQ84JK23e-66FD_ARATH; Protein FD
TrEMBLA0A0D2SGB40.0A0A0D2SGB4_G
STRINGAl_scaffold_0007_4533e-66(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19342772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.17e-62bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]