PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G188800.1
Common NameB456_007G188800, LOC105803652
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 659aa    MW: 74560 Da    PI: 5.6262
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G188800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.83.4e-5661331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtdeelv++yLk+k++g+k++l e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratksgyWkatgkd
  Gorai.007G188800.1   6 LPPGFRFHPTDEELVSYYLKRKINGRKIDL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKSGYWKATGKD 95 
                         79****************************.99***************6434555777********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v s +++ vg+kktLv+y+grap+g++tdWvmheyrl
  Gorai.007G188800.1  96 RKVNS-QTRGVGVKKTLVYYRGRAPHGSRTDWVMHEYRL 133
                         *****.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-634157IPR003441NAC domain
PROSITE profilePS5100561.4036157IPR003441NAC domain
PfamPF023652.4E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV SYYLKRKING RKIDLEIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKSGYWK ATGKDRKVNS QTRGVGVKKT LVYYRGRAPH  120
GSRTDWVMHE YRLDERECES ASTGFNDAYA LCRVFKKSAT TTPKMIGEHY STTVNNQIQI  180
TSEQSNSSLD LYSEGRCEES SDFGKPVDAC SSSILNRSSS SIDDICDARD VKWMQCFSED  240
AFGLINPSFS TYATIPYAPS KVDVALECAR LQQQMSLPPL EVEDFSQVGV ANHKVMMRTA  300
PMRETQHETD ILEEILSVAH ASQQLINQDA WGGSSSSNGH DFTFMNTMYQ HQNQINDQMN  360
CPLYTNQSLE GSSTRSTMVQ GDRMVENLRW VGMSGKDFEQ YCFMQENKVV PIQHISSFTD  420
TGVQGESGHD YNSIAINDTG IKDNEIEDIS HGFTEGDHFL DEGNIDDLRS SPSYEVVEDI  480
KFNHGMLVST RQVANTCFHQ ALPSQTVKVH QNPITATSYL QFQVGKPEPD EARYNIEKSF  540
FRKLYSFTKG QCTESLSFMK WCKDTASGFL CMAMLLLMRT FYLEFEEDTI SERLVDIGLN  600
AKDSKKEKKG VAVFGYSLAK SNGRWNDFGL LMTILAFFLI ISLVMCTLLA SILIHSFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-58215711168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6164141e-145JX616414.1 Gossypium hirsutum clone NBRI_GE61056 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491445.10.0PREDICTED: NAC domain-containing protein 86-like
TrEMBLA0A0D2QVJ70.0A0A0D2QVJ7_GOSRA; Uncharacterized protein
STRINGGorai.007G188800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101122632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-154NAC domain containing protein 28
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]