PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G147300.1
Common NameB456_007G147300, LOC105803214
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 255aa    MW: 29341 Da    PI: 6.5705
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G147300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.34.4e-51101371128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF P+deelv++yL kk++++++    ++ e+d++++ePw+Lp+++k + +ewyfFs rd+kyatg r+nrat+sgyWkatgkd+ 
  Gorai.007G147300.1  10 LPPGFRFYPSDEELVCHYLYKKIANEQVLK-GTLVEIDLHTCEPWQLPEAAKLNANEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRM 99 
                         79************************9655.78***************88888999*********************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         vl+  ++e+vg++ktLvfy++rap+g+kt W+mhe+rl
  Gorai.007G147300.1 100 VLDPtTEEVVGMRKTLVFYRNRAPNGVKTGWIMHEFRL 137
                         ***977888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-618156IPR003441NAC domain
PROSITE profilePS5100557.44210156IPR003441NAC domain
PfamPF023655.8E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLYK KIANEQVLKG TLVEIDLHTC EPWQLPEAAK  60
LNANEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRMV LDPTTEEVVG MRKTLVFYRN  120
RAPNGVKTGW IMHEFRLHTP HLPPKEEWVL CRVFHKSKEE NSAKLSSPMM LETSSTHHAH  180
ETAYQHISSL STTTPTYQSH AQCLLNLLQY NSHQENNSNE VSSKVDDGYE FLWDMEENSL  240
ECSWGGFQLG GHEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-48915616165NO APICAL MERISTEM PROTEIN
1ut4_B3e-48915616165NO APICAL MERISTEM PROTEIN
1ut7_A3e-48915616165NO APICAL MERISTEM PROTEIN
1ut7_B3e-48915616165NO APICAL MERISTEM PROTEIN
3swm_A4e-48915619168NAC domain-containing protein 19
3swm_B4e-48915619168NAC domain-containing protein 19
3swm_C4e-48915619168NAC domain-containing protein 19
3swm_D4e-48915619168NAC domain-containing protein 19
3swp_A4e-48915619168NAC domain-containing protein 19
3swp_B4e-48915619168NAC domain-containing protein 19
3swp_C4e-48915619168NAC domain-containing protein 19
3swp_D4e-48915619168NAC domain-containing protein 19
4dul_A3e-48915616165NAC domain-containing protein 19
4dul_B3e-48915616165NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269|PubMed:11114891}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472170.0KC847217.1 Gossypium hirsutum NAC domain protein NAC40 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001314147.10.0protein CUP-SHAPED COTYLEDON 3-like
RefseqXP_012490707.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ84TE63e-62NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A0D2SJY30.0A0A0D2SJY3_GOSRA; Uncharacterized protein
TrEMBLW6J8X80.0W6J8X8_GOSHI; NAC domain protein NAC40
STRINGGorai.007G147300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34362862
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.15e-91NAC domain containing protein 74
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  6. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  7. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]