PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G141500.2
Common NameB456_007G141500, LOC105803153
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 425aa    MW: 45726.6 Da    PI: 5.9139
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G141500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.82.6e-14209265359
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                         + kr+rr+ +NRe+ArrsR+RK+a++ eLe  v +L  e ++L k+l +++ ++++ 
  Gorai.007G141500.2 209 DAKRARRMRSNRESARRSRRRKQAQLNELEAQVGQLRVEHSTLLKRLTNMNHKYDEA 265
                         68******************************************9999998888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.9E-10206261No hitNo description
SMARTSM003382.7E-16207271IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.047209264IPR004827Basic-leucine zipper domain
PfamPF001701.1E-11210263IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.93E-9211261No hitNo description
PROSITE patternPS000360214229IPR004827Basic-leucine zipper domain
PfamPF124983.6E-25278398IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MNTVFSVDDF SDSFWAAPAS DDALGMTRSH SEWALERFLE EFSGAGVAIS GSHAGENVIG  60
PSLMAPQSSV SKVEEGDVVE IKRPNSQNHN HPPSDQTPTV PTASDDYHTI LKSKLELECA  120
AALAVKAEDS SAEAENHGLP SGSKVQGSSK VQGQGETDVA HCGTLTGSTT QKKSGVQVRQ  180
ATSGSSREDS DSDELEGDTE TADNMDPADA KRARRMRSNR ESARRSRRRK QAQLNELEAQ  240
VGQLRVEHST LLKRLTNMNH KYDEAAVDNR IMKADIETLR AKVKMAEETV KRVTGFNPAL  300
LSRPNVPSVG MPFVSNPLEA STVAPLPFQS NANQFFNQPV PNIVASIHHQ RVDNSFRGNT  360
LVPPDVNSQT KGVKNVNETS VLQHGPSLDC VPDQIGPGVS PCGPMPGWEP GLLPHAGDRN  420
NKQC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1223230RRSRRRKQ
2225230SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5773032e-35JX577303.1 Gossypium hirsutum clone NBRI_GE9096 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490637.10.0PREDICTED: basic leucine zipper 25 isoform X2
SwissprotQ9M1G67e-70BZP25_ARATH; Basic leucine zipper 25
TrEMBLA0A0D2SD130.0A0A0D2SD13_G
STRINGPOPTR_0005s23900.13e-83(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54620.12e-63basic leucine zipper 25
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]