PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G125000.1
Common NameB456_007G125000, LOC105802985
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 120aa    MW: 13507.7 Da    PI: 10.6973
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G125000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.44.7e-191649134
                GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                        C+ C tt TplWR gp g+++LCnaCG++yrkk+
  Gorai.007G125000.1 16 CVDCSTTRTPLWRGGPAGPRSLCNACGIRYRKKN 49
                        ********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011413.2171046IPR000679Zinc finger, GATA-type
SMARTSM004019.2E-151066IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.18E-141150No hitNo description
Gene3DG3DSA:3.30.50.107.0E-161450IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.62E-131550No hitNo description
PROSITE patternPS0034401641IPR000679Zinc finger, GATA-type
PfamPF003207.3E-171650IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MNILQQSEFK ETNKRCVDCS TTRTPLWRGG PAGPRSLCNA CGIRYRKKNR ALLGLNRESR  60
SEKSKRGIEV RRSGIKLKSF GREVGVQHMV GNRELKSKLR EEEEAAFLLM ALSCGYVYA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490362.17e-83PREDICTED: GATA transcription factor 16-like
TrEMBLA0A0D2SC658e-83A0A0D2SC65_G
STRINGVIT_05s0077g01450.t013e-31(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17347611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16141.12e-21GATA family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]