PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G110000.1
Common NameB456_007G110000, LOC105802815
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 172aa    MW: 19478.6 Da    PI: 6.2494
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G110000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601261.8e-3916114199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaC++lrr+C ++C+lapyfp +++ kfa vhk+FGasnv+k+++ ++e++reda+++lvyeA ar+rdPvyG++g i +lq+ +++lk
  Gorai.007G110000.1  16 PCAACRMLRRRCDSNCILAPYFPCDEMDKFAKVHKVFGASNVIKMIQMVEETNREDAVKALVYEATARMRDPVYGSTGAICQLQKMVQELK 106
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                          +l+++k+
  Gorai.007G110000.1 107 MQLESTKA 114
                         ***99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.47315116IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-3916113IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MGLESLIVTR PRTHQPCAAC RMLRRRCDSN CILAPYFPCD EMDKFAKVHK VFGASNVIKM  60
IQMVEETNRE DAVKALVYEA TARMRDPVYG STGAICQLQK MVQELKMQLE STKARVLELQ  120
QQKDQLWSVL MNVNHLDLLS PINGGDNFCL GYDDSIAYDP DKFPVVGDWI F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5819281e-65JX581928.1 Gossypium hirsutum clone NBRI_GE14664 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490141.11e-128PREDICTED: LOB domain-containing protein 25-like
SwissprotQ9SK082e-41LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0D2SI101e-128A0A0D2SI10_G
STRINGPOPTR_0014s16510.16e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1863068
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-42LOB domain-containing protein 11
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]