PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G079900.2
Common NameB456_007G079900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 253aa    MW: 28399.4 Da    PI: 9.286
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G079900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1095.5e-3427654129
                 NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++lvg+kktLvfykgrapkg+kt+Wvmhe+rle
  Gorai.007G079900.2   2 GEKEWYFFCVRDRKYPTGLRTNRATDAGYWKATGKDKEIFK-GKSLVGMKKTLVFYKGRAPKGQKTNWVMHEFRLE 76 
                         579**************************************.999****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100541.41100IPR003441NAC domain
SuperFamilySSF1019413.66E-382100IPR003441NAC domain
PfamPF023656.2E-16675IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MGEKEWYFFC VRDRKYPTGL RTNRATDAGY WKATGKDKEI FKGKSLVGMK KTLVFYKGRA  60
PKGQKTNWVM HEFRLEGQYS VYNLPKTAKN EWVICRVFQK SPNGKKVHIS GLPPLMDPSP  120
HTSETRTVVG AGETSNVTCF SDPIEDRKAV EEMMDSFDTS LVPCSSSSVN SLQKASYTTN  180
QIKSNMGNLQ YPDCFWIQEP SLLKTLIQSQ GGRPKQNLKL EFSQDSAVSN PEMIQLPACS  240
AGAIDLGYFW GY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-32110668171NO APICAL MERISTEM PROTEIN
1ut4_B4e-32110668171NO APICAL MERISTEM PROTEIN
1ut7_A4e-32110668171NO APICAL MERISTEM PROTEIN
1ut7_B4e-32110668171NO APICAL MERISTEM PROTEIN
3swm_A6e-32110671174NAC domain-containing protein 19
3swm_B6e-32110671174NAC domain-containing protein 19
3swm_C6e-32110671174NAC domain-containing protein 19
3swm_D6e-32110671174NAC domain-containing protein 19
3swp_A6e-32110671174NAC domain-containing protein 19
3swp_B6e-32110671174NAC domain-containing protein 19
3swp_C6e-32110671174NAC domain-containing protein 19
3swp_D6e-32110671174NAC domain-containing protein 19
4dul_A4e-32110668171NAC domain-containing protein 19
4dul_B4e-32110668171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ5071510.0KJ507151.1 Gossypium hirsutum subsp. latifolium isolate L67 NAC12 L-protein (NAC12) mRNA, complete cds.
GenBankKJ5071570.0KJ507157.1 Gossypium hirsutum subsp. latifolium isolate L19 NAC12 L-protein (NAC12) mRNA, complete cds.
GenBankKJ5071600.0KJ507160.1 Gossypium hirsutum subsp. latifolium isolate L108 NAC12 L-protein (NAC12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012489590.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ22e-78NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0D2SG400.0A0A0D2SG40_GOSRA; Uncharacterized protein
STRINGGorai.007G079900.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.13e-78NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]