PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G079900.1
Common NameB456_007G079900, LOC105802477
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 319aa    MW: 36123.1 Da    PI: 8.0359
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G079900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.73.7e-56161421129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL kkv ++ +++  +i evd++k+ePwdLp ++k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke
  Gorai.007G079900.1  16 LPPGFRFHPTDEELITHYLSKKVVDSFFSA-IAIGEVDLNKCEPWDLPWRAKMGEKEWYFFCVRDRKYPTGLRTNRATDAGYWKATGKDKE 105
                         79*************************999.88***************888999************************************* PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +++ +++lvg+kktLvfykgrapkg+kt+Wvmhe+rle
  Gorai.007G079900.1 106 IFK-GKSLVGMKKTLVFYKGRAPKGQKTNWVMHEFRLE 142
                         ***.999****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-6212166IPR003441NAC domain
PROSITE profilePS5100559.09916166IPR003441NAC domain
PfamPF023653.3E-2917141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MENVSSFRNE DEQMELPPGF RFHPTDEELI THYLSKKVVD SFFSAIAIGE VDLNKCEPWD  60
LPWRAKMGEK EWYFFCVRDR KYPTGLRTNR ATDAGYWKAT GKDKEIFKGK SLVGMKKTLV  120
FYKGRAPKGQ KTNWVMHEFR LEGQYSVYNL PKTAKNEWVI CRVFQKSPNG KKVHISGLPP  180
LMDPSPHTSE TRTVVGAGET SNVTCFSDPI EDRKAVEEMM DSFDTSLVPC SSSSVNSLQK  240
ASYTTNQIKS NMGNLQYPDC FWIQEPSLLK TLIQSQGGRP KQNLKLEFSQ DSAVSNPEMI  300
QLPACSAGAI DLGYFWGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-541317217174NAC domain-containing protein 19
3swm_B3e-541317217174NAC domain-containing protein 19
3swm_C3e-541317217174NAC domain-containing protein 19
3swm_D3e-541317217174NAC domain-containing protein 19
3swp_A3e-541317217174NAC domain-containing protein 19
3swp_B3e-541317217174NAC domain-containing protein 19
3swp_C3e-541317217174NAC domain-containing protein 19
3swp_D3e-541317217174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ5071600.0KJ507160.1 Gossypium hirsutum subsp. latifolium isolate L108 NAC12 L-protein (NAC12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012489590.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ21e-119NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0D2P5060.0A0A0D2P506_GOSRA; Uncharacterized protein
STRINGGorai.007G079900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-119NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]