PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G075700.1
Common NameB456_007G075700, LOC105801442
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 164aa    MW: 18186.6 Da    PI: 7.4412
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G075700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.98.2e-4411109199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC +dCv+apyfp e+p+kf nvhk+FGasnv+kl++++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l+
  Gorai.007G075700.1  11 PCAACKFLRRKCMPDCVFAPYFPPEEPQKFINVHKIFGASNVSKLINEVAPHQREDAVNSLAYEAEARLKDPVYGCVGAISILQRQVLRLQ 101
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                          el+++++
  Gorai.007G075700.1 102 RELDAIHA 109
                         ***99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.97410111IPR004883Lateral organ boundaries, LOB
PfamPF031955.5E-4311107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MASSSHSSNF PCAACKFLRR KCMPDCVFAP YFPPEEPQKF INVHKIFGAS NVSKLINEVA  60
PHQREDAVNS LAYEAEARLK DPVYGCVGAI SILQRQVLRL QRELDAIHAD LIRYATATCS  120
CNEMPPPMGR TCFHHNSSGN IYYPNPHWNE PYEGNGRSDG GSL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5883006e-52JX588300.1 Gossypium hirsutum clone NBRI_GE22688 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488202.11e-121PREDICTED: LOB domain-containing protein 25-like
RefseqXP_012488201.11e-121PREDICTED: LOB domain-containing protein 25-like
SwissprotQ9FML42e-66LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A0D2QNB91e-121A0A0D2QNB9_G
STRINGPOPTR_0001s35280.19e-77(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.43e-60LBD family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]