PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G065300.2
Common NameB456_007G065300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 289aa    MW: 31353 Da    PI: 4.2017
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G065300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM33.71.1e-10639135
                 NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevik 35
                        lppGfrFhPtd elv++yLk+kv g+kl l +vi+
  Gorai.007G065300.2  6 LPPGFRFHPTDVELVMYYLKRKVLGQKLLL-NVIA 39
                        79***********************99766.5555 PP

2NAM40.11.1e-12407594129
                 NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         + +ge+vg+ ktLvf+kg+ap+g +tdWvmheyrle
  Gorai.007G065300.2  40 KYNGEVVGMIKTLVFHKGKAPRGDRTDWVMHEYRLE 75 
                         448999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100515.509197IPR003441NAC domain
SuperFamilySSF1019411.16E-27397IPR003441NAC domain
PfamPF023656.4E-7731IPR003441NAC domain
PfamPF023657.5E-54674IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGKNTLPPGF RFHPTDVELV MYYLKRKVLG QKLLLNVIAK YNGEVVGMIK TLVFHKGKAP  60
RGDRTDWVMH EYRLEEKILA DRGPVQDMYM LYVVFKKDGL GPRNGSQYGA PFKEEEWSDD  120
EQADVPGAGS LCGLSTVAVG GDNSSCVPES VCVGPSVESS GWCTQPSMGH TNGDVNVTTA  180
IDTNAYAAPT CADAPEVPVV AVAEDVPTLL EAPQPALVPQ DQESNDNVLS MLECFFEEDA  240
FGTHEGLRRG NATDSSFKDT PVSDEDDISS LLASFTDVDN SNNWSYPF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472450.0KC847245.1 Gossypium hirsutum NAC domain protein NAC68 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313981.10.0NAC domain-containing protein 82-like
RefseqXP_012489350.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLA0A0D2T9W90.0A0A0D2T9W9_GOSRA; Uncharacterized protein
STRINGGorai.007G065300.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.19e-37NAC domain containing protein 103
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]