PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G065300.1
Common NameB456_007G065300, LOC105802325
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 348aa    MW: 38362.1 Da    PI: 4.5029
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G065300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1614.8e-5061341129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtd elv++yLk+kv g+kl l +vi++vd+yk+ PwdLp  +++k+++ +wyf+++ +kkya+g+r nrat  gyWkatgkd
  Gorai.007G065300.1   6 LPPGFRFHPTDVELVMYYLKRKVLGQKLLL-NVIAKVDVYKFAPWDLPdmSCMKTGDLKWYFYCPIEKKYARGDRVNRATIFGYWKATGKD 95 
                         79*************************988.99**************96448899999********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         ++v+  +ge+vg+ ktLvf+kg+ap+g +tdWvmheyrle
  Gorai.007G065300.1  96 RPVKY-NGEVVGMIKTLVFHKGKAPRGDRTDWVMHEYRLE 134
                         *****.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-573156IPR003441NAC domain
PROSITE profilePS5100552.8156156IPR003441NAC domain
PfamPF023654.1E-257133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGKNTLPPGF RFHPTDVELV MYYLKRKVLG QKLLLNVIAK VDVYKFAPWD LPDMSCMKTG  60
DLKWYFYCPI EKKYARGDRV NRATIFGYWK ATGKDRPVKY NGEVVGMIKT LVFHKGKAPR  120
GDRTDWVMHE YRLEEKILAD RGPVQDMYML YVVFKKDGLG PRNGSQYGAP FKEEEWSDDE  180
QADVPGAGSL CGLSTVAVGG DNSSCVPESV CVGPSVESSG WCTQPSMGHT NGDVNVTTAI  240
DTNAYAAPTC ADAPEVPVVA VAEDVPTLLE APQPALVPQD QESNDNVLSM LECFFEEDAF  300
GTHEGLRRGN ATDSSFKDTP VSDEDDISSL LASFTDVDNS NNWSYPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-47513314140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the epidermal cells of the root apical region. {ECO:0000269|PubMed:20388856}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472450.0KC847245.1 Gossypium hirsutum NAC domain protein NAC68 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313981.10.0NAC domain-containing protein 82-like
RefseqXP_012489350.10.0PREDICTED: NAC domain-containing protein 78-like
SwissprotQ9FY822e-91NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A0D2S8020.0A0A0D2S802_GOSRA; Uncharacterized protein
TrEMBLW6JAQ50.0W6JAQ5_GOSHI; NAC domain protein NAC68
STRINGGorai.007G065300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36922562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.45e-93NAC domain containing protein 82
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  4. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]