PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G043900.1
Common NameB456_007G043900, LOC105802121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 237aa    MW: 27314.2 Da    PI: 9.9281
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G043900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM152.81.6e-47121351128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF+Pt+eelv +yLk k+ + +l++ ++i++++i++++PwdLp ++    +e yfFs ++ ky+tg+r nrat+sgyWkatg+dk+
  Gorai.007G043900.1  12 LPPGFRFQPTEEELVFQYLKCKAFSFPLPA-SIIPDLNICNFDPWDLPGEL---GEERYFFSMKEAKYKTGNRINRATASGYWKATGSDKK 98 
                         79****************************.89***************553...5799********************************* PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s+++++ g++ktLvf+ g+ p+g +tdW+mheyrl
  Gorai.007G043900.1  99 IISRRNQVAGMRKTLVFHMGKPPHGLRTDWIMHEYRL 135
                         ***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-548170IPR003441NAC domain
PROSITE profilePS5100551.41112170IPR003441NAC domain
PfamPF023654.2E-2413135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MNSLRLNGLR KLPPGFRFQP TEEELVFQYL KCKAFSFPLP ASIIPDLNIC NFDPWDLPGE  60
LGEERYFFSM KEAKYKTGNR INRATASGYW KATGSDKKII SRRNQVAGMR KTLVFHMGKP  120
PHGLRTDWIM HEYRLVNVPN NDFNLANNPM MQNYLNHEME KWVLCHVFLK KTSKKSSEEE  180
IMQSFCNKNR NKALGHRMEP KVYNFMREKD AEPSSSSSAS SRSDITEVSS SACSRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-441217517170NO APICAL MERISTEM PROTEIN
1ut4_B7e-441217517170NO APICAL MERISTEM PROTEIN
1ut7_A7e-441217517170NO APICAL MERISTEM PROTEIN
1ut7_B7e-441217517170NO APICAL MERISTEM PROTEIN
3swm_A7e-441217520173NAC domain-containing protein 19
3swm_B7e-441217520173NAC domain-containing protein 19
3swm_C7e-441217520173NAC domain-containing protein 19
3swm_D7e-441217520173NAC domain-containing protein 19
3swp_A7e-441217520173NAC domain-containing protein 19
3swp_B7e-441217520173NAC domain-containing protein 19
3swp_C7e-441217520173NAC domain-containing protein 19
3swp_D7e-441217520173NAC domain-containing protein 19
4dul_A7e-441217517170NAC domain-containing protein 19
4dul_B7e-441217517170NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}.
UniprotTISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012489037.11e-179PREDICTED: NAC transcription factor 25-like
SwissprotQ9FY934e-68NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A0D2QLE91e-177A0A0D2QLE9_GOSRA; Uncharacterized protein
STRINGGorai.007G043900.11e-178(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2207445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.12e-68NAC domain containing protein 83
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]