PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G038100.2
Common NameB456_007G038100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 269aa    MW: 30193.2 Da    PI: 8.9259
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G038100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM110.22.3e-3427554128
                 NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +ekewyfF+ rd+ky+tg r+nrat+sgyWkatgkdke++  +++lvg+kktLvfy+grapkg kt+Wvmheyrl
  Gorai.007G038100.2   2 GEKEWYFFCVRDRKYPTGLRTNRATDSGYWKATGKDKEIYM-GKSLVGMKKTLVFYQGRAPKGAKTNWVMHEYRL 75 
                         579**************************************.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100541.6341100IPR003441NAC domain
SuperFamilySSF1019419.81E-402100IPR003441NAC domain
PfamPF023652.3E-16675IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGEKEWYFFC VRDRKYPTGL RTNRATDSGY WKATGKDKEI YMGKSLVGMK KTLVFYQGRA  60
PKGAKTNWVM HEYRLDGKFS IQNLPKTAKN EWVICRVFQK SSDGKKIPIS SLVKASCLSN  120
ELGPATGLPP LMDSSPYNGG KSEPVFADST YVPCFSNPIG SQTNQQITID HNFNYRTLHV  180
SSNPCHVLPQ NPFYAAEFES LGSVQEQSML RTLIENHGSK VQAEREIVRK PEMLFVSNLE  240
SGKKPFDDQH APSSSSAGPV DLDCFWHY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-34110668171NO APICAL MERISTEM PROTEIN
1ut4_B7e-34110668171NO APICAL MERISTEM PROTEIN
1ut7_A7e-34110668171NO APICAL MERISTEM PROTEIN
1ut7_B7e-34110668171NO APICAL MERISTEM PROTEIN
4dul_A7e-34110668171NAC domain-containing protein 19
4dul_B7e-34110668171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472140.0KC847214.1 Gossypium hirsutum NAC domain protein NAC37 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488927.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ28e-97NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0D2P2J40.0A0A0D2P2J4_GOSRA; Uncharacterized protein
STRINGGorai.007G038100.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.13e-99NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]