PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G034800.1
Common NameB456_007G034800, LOC105801416
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 298aa    MW: 33436.3 Da    PI: 6.3823
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G034800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.55.3e-3910108199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rrkC ++C lapyfpa+q+k f+n+hklFG+sn++k+lk+l+++++ +am+s+ y+A++r + PvyG++gvi++l  q++ l+
  Gorai.007G034800.1  10 ACAACKYQRRKCIPECLLAPYFPADQTKVFQNAHKLFGVSNIVKILKSLDPSQHAEAMRSIKYQANVRDKFPVYGCLGVIRQLYYQIQLLE 100
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                         +e +++ +
  Gorai.007G034800.1 101 EEFHSVLS 108
                         *9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.1619110IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-3710105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MTLKSGTTSA CAACKYQRRK CIPECLLAPY FPADQTKVFQ NAHKLFGVSN IVKILKSLDP  60
SQHAEAMRSI KYQANVRDKF PVYGCLGVIR QLYYQIQLLE EEFHSVLSQL EVYRQHHHEV  120
PSQLELGMAP PTNGLHFLTA VSDMPVSMQH SYSNSNNIGY CSSYVDSKDH NNNKNNSNSS  180
SNSNSNNNSL WIQHPFLATN NSSSSNSNEN NPLMAIQSQL LVSNTQPLVI QHEVVQDYDE  240
LHPFFDTIDD RQFFIHSKEP YDSSCEDSAK ETTQAIELVP NNELKNAAAC FSLTSVH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6148990.0JX614899.1 Gossypium hirsutum clone NBRI_GE58613 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488173.10.0PREDICTED: LOB domain-containing protein 27-like
SwissprotQ9STS66e-61LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A0D2S6930.0A0A0D2S693_G
STRINGPOPTR_0012s07390.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.17e-55LOB domain-containing protein 27
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]