PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G017500.3
Common NameB456_007G017500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 398aa    MW: 44603.6 Da    PI: 4.8829
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G017500.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.92e-5391371128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lp G+rF+Ptdeel+++yL++kv+gk+ ++  vi+evd++k+ePwdLp+  +vk+++ ew+fF++ d+ky++g+r nrat++gyWkatgkd
  Gorai.007G017500.3   9 LPIGIRFRPTDEELIDFYLRAKVNGKRKDEIGVIREVDVCKCEPWDLPHlsAVKGRDPEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKD 99 
                         699************************999899***************4347788888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++s ++ l+g+kktLvfy+grapkg++t+Wvmheyr 
  Gorai.007G017500.3 100 RKIKS-GSCLIGMKKTLVFYTGRAPKGKRTNWVMHEYRT 137
                         *****.99*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-604160IPR003441NAC domain
PROSITE profilePS5100556.5789160IPR003441NAC domain
PfamPF023653.5E-2710136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MAVISLNSLP IGIRFRPTDE ELIDFYLRAK VNGKRKDEIG VIREVDVCKC EPWDLPHLSA  60
VKGRDPEWFF FCPLDRKYPN GNRLNRATEA GYWKATGKDR KIKSGSCLIG MKKTLVFYTG  120
RAPKGKRTNW VMHEYRTTLD ELDGTKPGQN PFVICRLFKK QDVTIEDINA DDVDPGASSH  180
TEEVQSEFDG PSVEGGAGKV PDETRPVGLC NEAVAPIFDC NNGGFNACEL EEMAPAQVDL  240
LGEALVQFCD PMMEPLDWKL FSPLHSQIEA EGAPWMFDHV GNSFGGVKFE HGTNENDAEF  300
MNSILNNLDD YYSDDSSSRR NSVIETETPK SMAFGTNGGL YCKPDAEPAQ VLVSSRTKLV  360
TYLFTVSIFI EIMKCLIELL FKIHTAWDRN CQRRSIL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-41816116166NO APICAL MERISTEM PROTEIN
1ut4_B2e-41816116166NO APICAL MERISTEM PROTEIN
1ut7_A2e-41816116166NO APICAL MERISTEM PROTEIN
1ut7_B2e-41816116166NO APICAL MERISTEM PROTEIN
3swm_A2e-41816119169NAC domain-containing protein 19
3swm_B2e-41816119169NAC domain-containing protein 19
3swm_C2e-41816119169NAC domain-containing protein 19
3swm_D2e-41816119169NAC domain-containing protein 19
3swp_A2e-41816119169NAC domain-containing protein 19
3swp_B2e-41816119169NAC domain-containing protein 19
3swp_C2e-41816119169NAC domain-containing protein 19
3swp_D2e-41816119169NAC domain-containing protein 19
4dul_A2e-41816116166NAC domain-containing protein 19
4dul_B2e-41816116166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.4500.0seedling
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO487957290.0
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator essential for the anti-viral defense called virus basal resistance response pathway (PubMed:11041886, PubMed:15629774, PubMed:18785827, PubMed:24418554). Not involved in HRT-mediated hypersensitive response (HR) and resistance to TCV (PubMed:18785827). Binds DNA non specifically (PubMed:15629774). Activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). {ECO:0000250|UniProtKB:Q9SCK6, ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774, ECO:0000269|PubMed:18785827, ECO:0000269|PubMed:24418554}.; FUNCTION: (Microbial infection) Compromised function in defense response pathway when interacting with the invading viral capsid protein (CP) of turnip crinkle virus (TCV) due to abnormal subcellular localization. {ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by bacterial pathogens type III effector proteins (TTEs). {ECO:0000269|PubMed:16553893}.; INDUCTION: (Microbial infection) Accumulates 2 days post infection with turnip crinkle virus (TCV) (PubMed:24418554). {ECO:0000269|PubMed:24418554}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472260.0KC847226.1 Gossypium hirsutum NAC domain protein NAC49 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488635.10.0PREDICTED: NAC domain-containing protein 62-like
SwissprotQ9LKG85e-90NAC91_ARATH; NAC domain-containing protein 91
TrEMBLA0A0D2QK100.0A0A0D2QK10_GOSRA; Uncharacterized protein
STRINGGorai.007G017500.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.27e-91TCV-interacting protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Ben Daniel BH, et al.
    Identification of novel transcriptional regulators of Zat12 using comprehensive yeast one-hybrid screens.
    Physiol Plant, 2016. 157(4): p. 422-41
    [PMID:26923089]
  4. Li Y, et al.
    The interaction between Turnip crinkle virus p38 and Cucumber mosaic virus 2b and its critical domains.
    Virus Res., 2016. 222: p. 94-105
    [PMID:27288723]