PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G017500.1
Common NameB456_007G017500, LOC105801855
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 526aa    MW: 58544.3 Da    PI: 6.0112
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G017500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.13.4e-5391371128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lp G+rF+Ptdeel+++yL++kv+gk+ ++  vi+evd++k+ePwdLp+  +vk+++ ew+fF++ d+ky++g+r nrat++gyWkatgkd
  Gorai.007G017500.1   9 LPIGIRFRPTDEELIDFYLRAKVNGKRKDEIGVIREVDVCKCEPWDLPHlsAVKGRDPEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKD 99 
                         699************************999899***************4347788888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++s ++ l+g+kktLvfy+grapkg++t+Wvmheyr 
  Gorai.007G017500.1 100 RKIKS-GSCLIGMKKTLVFYTGRAPKGKRTNWVMHEYRT 137
                         *****.99*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-604160IPR003441NAC domain
PROSITE profilePS5100556.5789160IPR003441NAC domain
PfamPF023656.0E-2710136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MAVISLNSLP IGIRFRPTDE ELIDFYLRAK VNGKRKDEIG VIREVDVCKC EPWDLPHLSA  60
VKGRDPEWFF FCPLDRKYPN GNRLNRATEA GYWKATGKDR KIKSGSCLIG MKKTLVFYTG  120
RAPKGKRTNW VMHEYRTTLD ELDGTKPGQN PFVICRLFKK QDVTIEDINA DDVDPGASSH  180
TEEVQSEFDG PSVEGGAGKV PDETRPVGLC NEAVAPIFDC NNGGFNACEL EEMAPAQVDL  240
LGEALVQFCD PMMEPLDWKL FSPLHSQIEA EGAPWMFDHV GNSFGGVKFE HGTNENDAEF  300
MNSILNNLDD YYSDDSSSRR NSVIETETPK SMAFGTNGGL YCKPDAEPAQ VLLGTGTANG  360
GAFYNVLNSN GEPSNHVNTA CNVDTAPTIR IRSRAHRIQP DTENFDTQGI ASRRCKLVVH  420
SPRFEAKEHD SKPILPKGVK AMEEYISVDS DAARRTMDEP QIFETSKRDV SRLKSKVPVS  480
EAVSYRCLKR FSARRQHKPF SVIMFRVVAV MLILFVALVS TLNVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-41816116166NO APICAL MERISTEM PROTEIN
1ut4_B8e-41816116166NO APICAL MERISTEM PROTEIN
1ut7_A8e-41816116166NO APICAL MERISTEM PROTEIN
1ut7_B8e-41816116166NO APICAL MERISTEM PROTEIN
3swm_A1e-40816119169NAC domain-containing protein 19
3swm_B1e-40816119169NAC domain-containing protein 19
3swm_C1e-40816119169NAC domain-containing protein 19
3swm_D1e-40816119169NAC domain-containing protein 19
3swp_A1e-40816119169NAC domain-containing protein 19
3swp_B1e-40816119169NAC domain-containing protein 19
3swp_C1e-40816119169NAC domain-containing protein 19
3swp_D1e-40816119169NAC domain-containing protein 19
4dul_A8e-41816116166NAC domain-containing protein 19
4dul_B8e-41816116166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.4500.0seedling
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO487957290.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472260.0KC847226.1 Gossypium hirsutum NAC domain protein NAC49 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488635.10.0PREDICTED: NAC domain-containing protein 62-like
TrEMBLA0A0D2SCK70.0A0A0D2SCK7_GOSRA; Uncharacterized protein
STRINGGorai.007G017500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24162873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.24e-90TCV-interacting protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]