PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G229500.1
Common NameB456_006G229500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 389aa    MW: 42251.8 Da    PI: 5.9676
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G229500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.91.2e-09216274563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         kr++r   NR +A rs +RK  +i+eLe+k+++L++e ++L+ +l  l+  ++ + +e+
  Gorai.006G229500.1 216 KRAKRIWANRQSAARSKERKMRYIAELERKIQTLQTEATSLAAQLTLLQRDSSGMSAEN 274
                         9*********************************************9998888777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-14212276IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.507214277IPR004827Basic-leucine zipper domain
PfamPF001702.3E-8216273IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.16E-10216266No hitNo description
Gene3DG3DSA:1.20.5.1702.8E-7216268No hitNo description
CDDcd147032.79E-24217266No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MEKDKSPCLP PMSGRVPGFS SSGNAASTSN AISETGNFGQ TSDSNSFSHD ISKMPDNPPK  60
NLGHRRAHSE IITLPDDINF DGDLGVVGAA DGPSYSDETE DDMLSMYLDI DKFNSSSVTS  120
MFQVGKSLTT TAPNSGPSAA VSMGAGTATS GEENASVGVG SSEKPRIRHQ HSQSMDGSTS  180
IKPEMLLSGS DEVTPADSKK AMSAAKLAEL ALIDPKRAKR IWANRQSAAR SKERKMRYIA  240
ELERKIQTLQ TEATSLAAQL TLLQRDSSGM SAENSELKLR LQTMEQQVYL QDSLNDALKE  300
EIHQQYIPNN HAMQAVLTAQ QFQQLQIQLQ KHQHQFPPHQ LHQLQQQLQL QQELQQQAGE  360
MRVRGSMPSP NRRDGPSSSD VSSTASND*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487039.10.0PREDICTED: probable transcription factor PosF21
RefseqXP_012487040.10.0PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-133POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A0D2T2Z40.0A0A0D2T2Z4_G
STRINGVIT_05s0102g01120.t011e-147(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-107bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]