PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G220700.1
Common NameB456_006G220700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 68aa    MW: 8095.38 Da    PI: 10.7358
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G220700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.71.6e-10459459
                        XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59
                         k+++r  +NR A  rsR+RKk++++  e k+  Le+e ++L   l+  + e ++l
  Gorai.006G220700.1  4 AKKQKRQLRNRDAVVRSRERKKMYVKDFEMKSRYLEGECRRLSHVLQCFSAENQAL 59
                        69****************************************99888777777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0044165IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.898360IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-12460No hitNo description
PfamPF001706.5E-10459IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.56E-11560No hitNo description
CDDcd147041.30E-11657No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
DPIAKKQKRQ LRNRDAVVRS RERKKMYVKD FEMKSRYLEG ECRRLSHVLQ CFSAENQALQ  60
IFFFSSP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447655.16e-30PREDICTED: bZIP transcription factor 60-like
SwissprotQ9C7S08e-13BZP60_ARATH; bZIP transcription factor 60
TrEMBLA0A0D2QES75e-43A0A0D2QES7_G
STRINGGLYMA02G19754.17e-25(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.15e-14basic region/leucine zipper motif 60
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]