PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G203800.6
Common NameB456_006G203800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 378aa    MW: 42649.4 Da    PI: 4.3984
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G203800.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.92.3e-5491371128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lp GfrF+Ptdeel+++yL+ k++g+++++ e+i+e+d++k+ePwdLp  +++k+++ ew+fF++ d+ky+tg+r nrat++gyWkatgkd
  Gorai.006G203800.6   9 LPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPdlSAIKTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKD 99 
                         699************************999999**************96448888999********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++s +++l+g+kktLvfy+grap+g++t+Wvmheyr 
  Gorai.006G203800.6 100 RKIKS-GSTLIGMKKTLVFYNGRAPRGKRTNWVMHEYRT 137
                         *****.99*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.02E-616160IPR003441NAC domain
PROSITE profilePS5100557.6589160IPR003441NAC domain
PfamPF023651.2E-2710136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009814Biological Processdefense response, incompatible interaction
GO:0010200Biological Processresponse to chitin
GO:0070417Biological Processcellular response to cold
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MGVLLLNSLP LGFRFRPTDE ELIHFYLRSK INGNRNDEIE IIREIDVCKC EPWDLPDLSA  60
IKTQDPEWFF FCPLDRKYPT GNRLNRATEA GYWKATGKDR KIKSGSTLIG MKKTLVFYNG  120
RAPRGKRTNW VMHEYRTTLD ELDGTKPGQN AFVICRIFKK QDETIEDINS DEVDPSVLSP  180
TEDMASELEV PQASPTVKQE AEKACDTSET CFASFPDEVI SNAVAPIFEG NSDNHDNYNE  240
IDQVAEISPA EVDLLEEALN HFYDPMMEPL FSPLHNQIEA EQAPWMFDHV GNCYNVEFGH  300
GTNENDPYIS NFLESILKNS DDYHGDDTGS QKNSESETHT TMTIGKDGGF CSKPDSEVAQ  360
VLVSRGKLVT CHLSYSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-43816116166NO APICAL MERISTEM PROTEIN
1ut4_B4e-43816116166NO APICAL MERISTEM PROTEIN
1ut7_A4e-43816116166NO APICAL MERISTEM PROTEIN
1ut7_B4e-43816116166NO APICAL MERISTEM PROTEIN
4dul_A4e-43816116166NAC domain-containing protein 19
4dul_B4e-43816116166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.37140.0flower|seedling| flowering
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, rosette leaves, cauline leaves and stems. {ECO:0000269|PubMed:17158162}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator essential for the anti-viral defense called virus basal resistance response pathway (PubMed:11041886, PubMed:15629774, PubMed:18785827, PubMed:24418554). Not involved in HRT-mediated hypersensitive response (HR) and resistance to TCV (PubMed:18785827). Binds DNA non specifically (PubMed:15629774). Activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). {ECO:0000250|UniProtKB:Q9SCK6, ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774, ECO:0000269|PubMed:18785827, ECO:0000269|PubMed:24418554}.; FUNCTION: (Microbial infection) Compromised function in defense response pathway when interacting with the invading viral capsid protein (CP) of turnip crinkle virus (TCV) due to abnormal subcellular localization. {ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774}.
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:20156199, PubMed:19947982). Transcriptional activator involved in response to cold stress. Mediates induction of pathogenesis-related (PR) genes independently of salicylic signaling in response to cold. Binds directly to the PR gene promoters and enhances plant resistance to pathogen infection, incorporating cold signals into pathogen resistance responses (PubMed:19947982). Plays a regulatory role in abscisic acid (ABA)-mediated drought-resistance response (PubMed:22967043). {ECO:0000269|PubMed:19947982, ECO:0000269|PubMed:20156199, ECO:0000269|PubMed:22967043}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00398DAPTransfer from AT3G49530Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt, drought stress, abscisic acid (ABA), salicylic acid (SA) and methyl methanesulfonate (MMS) treatment. {ECO:0000269|PubMed:17158162}.
UniProtINDUCTION: Induced by bacterial pathogens type III effector proteins (TTEs). {ECO:0000269|PubMed:16553893}.; INDUCTION: (Microbial infection) Accumulates 2 days post infection with turnip crinkle virus (TCV) (PubMed:24418554). {ECO:0000269|PubMed:24418554}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472080.0KC847208.1 Gossypium hirsutum NAC domain protein NAC31 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313704.10.0NAC domain-containing protein 62-like
RefseqXP_012486606.10.0PREDICTED: NAC domain-containing protein 62-like
SwissprotQ9LKG87e-96NAC91_ARATH; NAC domain-containing protein 91
SwissprotQ9SCK61e-95NAC62_ARATH; NAC domain-containing protein 62
TrEMBLA0A0D2QDR50.0A0A0D2QDR5_GOSRA; Uncharacterized protein
STRINGGorai.006G203800.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.11e-87NAC domain containing protein 62
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Ben Daniel BH, et al.
    Identification of novel transcriptional regulators of Zat12 using comprehensive yeast one-hybrid screens.
    Physiol Plant, 2016. 157(4): p. 422-41
    [PMID:26923089]
  5. Li Y, et al.
    The interaction between Turnip crinkle virus p38 and Cucumber mosaic virus 2b and its critical domains.
    Virus Res., 2016. 222: p. 94-105
    [PMID:27288723]