PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G189600.2
Common NameB456_006G189600, LOC105800026
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 239aa    MW: 27390.6 Da    PI: 4.6082
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G189600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.63.4e-5561331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtdeelv++yLk+k++g+++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd
  Gorai.006G189600.2   6 LPPGFRFHPTDEELVNYYLKRKINGQEIEL-DIIPEVDLYKCEPWELAeKsILPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKD 95 
                         79****************************.99**************84334556788********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v s +++++g+kktLv+y+grap+g +tdWvmheyrl
  Gorai.006G189600.2  96 RRVAS-QNRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 133
                         *****.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-644157IPR003441NAC domain
PROSITE profilePS5100560.2156156IPR003441NAC domain
PfamPF023651.9E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKING QEIELDIIPE VDLYKCEPWE LAEKSILPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVAS QNRAIGMKKT LVYYRGRAPQ  120
GIRTDWVMHE YRLDDKESED YCGIQDSYAL CRVFKKNGIC SETEDQGRCN MLVMECSQSV  180
INDSETMSPD LPLASSSSFI EEEDKDDSWM QFITDDPWCS SNTTALAGDD VSNVALTN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-56215711169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8471990.0KC847199.1 Gossypium hirsutum NAC domain protein NAC22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012486348.11e-180PREDICTED: NAC domain-containing protein 86 isoform X3
SwissprotA4VCM04e-90NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A0D2QCY71e-179A0A0D2QCY7_GOSRA; Uncharacterized protein
STRINGGorai.006G189600.11e-178(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-128NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]