PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G183000.1
Common NameB456_006G183000, LOC105799954
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 286aa    MW: 34349.5 Da    PI: 7.6654
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G183000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.32.4e-2439121186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         +W+ qe+++ + +r e+++++ ++k++k lWe +s +mre+gf+rs +qCk+kw+nl +ryk ++++e++     ++++p++++l+
  Gorai.006G183000.1  39 QWSIQETKEFLMIRAELDRSFMETKRNKLLWEVISTRMREKGFNRSTEQCKCKWKNLVTRYKGCETMEEEA---MRQQFPFYNELQ 121
                         7********************************************************************95...56689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.17E-2138103No hitNo description
PfamPF138377.0E-2039123No hitNo description
PROSITE profilePS500907.3174096IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MEGHQHHHHQ YQQQQYQYHQ QQQQPPTSSV NVDPDRFPQW SIQETKEFLM IRAELDRSFM  60
ETKRNKLLWE VISTRMREKG FNRSTEQCKC KWKNLVTRYK GCETMEEEAM RQQFPFYNEL  120
QAIFSARMQS ILWSESEGGV TGSKRKAVQL SSDEEEDTEE KELERSSVRK KKQGKTSGGA  180
GIGGSTSGNG NNSNNIKEIL EDFMRQQMQM EMQWREAFEA REHERRLKEM EWRQKMEALE  240
NERILMDRRW YEREEQRRMR EEARAEKRDA LITALLNKLR RDDHM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A2e-1236119386DNA binding protein GT-1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in roots and flower buds. {ECO:0000269|PubMed:15044016}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GTTAC-3'. {ECO:0000269|PubMed:15044016}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN1277682e-77JN127768.1 Theobroma cacao clone TCC_BC011L18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012486231.10.0PREDICTED: trihelix transcription factor GT-3b
SwissprotQ9SDW01e-73TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A0D2QCA70.0A0A0D2QCA7_GOSRA; Uncharacterized protein
STRINGGorai.006G183000.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.19e-54Trihelix family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]