PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G155600.1
Common NameB456_006G155600, LOC105799681
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 415aa    MW: 45644.1 Da    PI: 9.4971
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G155600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.38.2e-14330382557
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                         +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN+ Lk  l el+ + +
  Gorai.006G155600.1 330 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKQENSHLKRALAELERKRK 382
                         79*******************************************99997765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-13326387IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.783328380IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.63E-10330380No hitNo description
PfamPF001708.9E-12330382IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.4E-14330383No hitNo description
CDDcd147074.48E-23330384No hitNo description
PROSITE patternPS000360333348IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010152Biological Processpollen maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MVVSESEIGE VESPLQGANQ QQKNHPFSEL GRQSSIYSLT LDEFQHTLCD GGKNFGSMNM  60
DEFLTSIWNA EENQAINSNN NNTNHQNNSG NKQVSDQVHL SFNETSSSKG IAKQPSLPRQ  120
GSLTLPAPLC RKTVDEVWSE IQRGQQGQGQ SNNSNVQTAD ENASTRRQPT FGEMTLEDFL  180
IKAGVVREQC MPPQPPPVLP SPHHQPPQYG LYQTGNNPAV SPGFVSRPVG FSGTAYQTMP  240
PGLNDGKTGG AYQPAAPPLT TVIYNGKVTG GGGYGLGKTI GGVAPVSPVS SERLCTNQVD  300
NAASQFGMEM VAVRGRQRII DGPIEKVVER RQRRMIKNRE SAARSRARKQ AYTVELEAEL  360
NQLKQENSHL KRALAELERK RKQQCFEEWK TKTQTKARKA REKLRIMRSL SCPL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485807.10.0PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X1
RefseqXP_012485808.10.0PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X2
SwissprotQ9SJN01e-117ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A0D2RWY70.0A0A0D2RWY7_G
STRINGSolyc09g009490.2.11e-142(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM92012536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.11e-109bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]