PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G149100.1
Common NameB456_006G149100, LOC105799615
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 645aa    MW: 70119.4 Da    PI: 7.588
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G149100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-093623991954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Gorai.006G149100.1 362 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 399
                         554459******************************88 PP

2BELL120.66.7e-39226297172
                BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         erqe+q+kkakL+s+l+eVd+rY+qy++q+q+vis Fe+ ag+gsak Yt+lAlk+iS++FrcLkdai++qi
  Gorai.006G149100.1 226 ERQEIQMKKAKLISMLDEVDQRYRQYHHQIQIVISTFEQTAGIGSAKTYTALALKTISKQFRCLKDAIIGQI 297
                         79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.7E-62148295IPR006563POX domain
PfamPF075263.1E-50153293IPR006563POX domain
PROSITE profilePS5007112.195340403IPR001356Homeobox domain
CDDcd000863.33E-12343404No hitNo description
SMARTSM003895.3E-9343407IPR001356Homeobox domain
SuperFamilySSF466898.13E-17344409IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.1E-29346409IPR009057Homeodomain-like
PfamPF059202.6E-18360399IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
MATYFHGNPE IQAADDLQTL VLMNPAYVHY SNTPPPPPPS NNLVFVNSLS PNAPSSHSQQ  60
LVGIPLPAVT SGSNQDAISS LHGLVQRLHY NSYNPIDPSG EPRDTPRAQQ GLSLTLSSQH  120
QPGNYGSQPQ AVSGGSASSG SAVTNGVSGI QSVLLSSKYL KAAQELLDEV VNVDNTGFTK  180
TEMAKKGSGN DSNSSKATGE LSAAAGDGSG GENAVGKRRT ELSTAERQEI QMKKAKLISM  240
LDEVDQRYRQ YHHQIQIVIS TFEQTAGIGS AKTYTALALK TISKQFRCLK DAIIGQIRAV  300
NKSLGEEDRL GGKTEGSRLK FVDHQLRQQR ALQQLGMIQH NAWRPQRGLP ERSVSVLRAW  360
LFEHFLHPYP KDSDKHMLAK QTGLTRSQVS NWFINARVRL WKPMVEEMYL EEIKEQEQNH  420
EGSASKSTGP TPAKNQAKSL SSSKQDNSAN QNASSMSISM ASTSPLAGNG QNQSGFSFIG  480
SSELEGITQG SPKKPRSTEV LLQSPIDMDI KQREAADDVS IKFGKEGYSF MGTDTNFMGG  540
FGQYPIAEMA RFDAEHFAPR FPGNGVSLTL GLPHCENLSL PATHQTFLPN QTLQMGRRLD  600
IGEPNEYGAI NPSTPHSSVA YEIENIDVQN RKRFAAQLLP DFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16349407563Homeobox protein Meis2
3k2a_B3e-16349407563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.650.0flower|seedling| flowering
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485724.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_012485725.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_012485726.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_012485727.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0D2SY520.0A0A0D2SY52_G
STRINGPOPTR_0006s21950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-161BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]