PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G127700.1
Common NameB456_006G127700, LOC105797928
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 344aa    MW: 39752.6 Da    PI: 4.9166
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G127700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.41.7e-46651902128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         ppG+rF P deelv +yLkkkv + +l+  + i ev++y+++P++L     + +ekewyfF++rdkky++g+r+nra+  gyWkatg d+e
  Gorai.006G127700.1  65 PPGYRFCPLDEELVLYYLKKKVLNLPLPQ-NRIVEVNLYQYNPERLAeLYKQYGEKEWYFFTPRDKKYRNGTRPNRAAVGGYWKATGADRE 154
                         9*************************999.77**************8334455899*********************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v   k++ vg +k Lvfykgr pkg kt+W+mheyr+
  Gorai.006G127700.1 155 VRF-KDRIVGYRKALVFYKGRPPKGDKTSWIMHEYRV 190
                         **9.8899***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-5463219IPR003441NAC domain
PROSITE profilePS5100554.52564219IPR003441NAC domain
PfamPF023651.8E-2465190IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MEVEPKRELC DTNQTPEKIP PLSLHHASSS DALGIVEAPE NEEPIVNGTN NKDKVDDDGY  60
LDSFPPGYRF CPLDEELVLY YLKKKVLNLP LPQNRIVEVN LYQYNPERLA ELYKQYGEKE  120
WYFFTPRDKK YRNGTRPNRA AVGGYWKATG ADREVRFKDR IVGYRKALVF YKGRPPKGDK  180
TSWIMHEYRV NDPPPLCSKK EGYTDMRLDD YVLCRIYKKV DKSGRTQTKT EDGLALTQKQ  240
ERDEMMGSED TMNYLSTMGM GMGMGGNFMN QAFPEFQYIF NDQFPSSFPT KYLNDRLEQE  300
DVWSFDFPPQ LDVSVEALIN VDNVFSPDTA NKNSTNSEMN TRD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-506321916165NO APICAL MERISTEM PROTEIN
1ut4_B2e-506321916165NO APICAL MERISTEM PROTEIN
1ut7_A2e-506321916165NO APICAL MERISTEM PROTEIN
1ut7_B2e-506321916165NO APICAL MERISTEM PROTEIN
4dul_A2e-506321916165NAC domain-containing protein 19
4dul_B2e-506321916165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with male fertility. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472530.0KC847253.1 Gossypium hirsutum NAC domain protein NAC76 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313730.10.0NAC transcription factor ONAC010-like
RefseqXP_012483251.10.0PREDICTED: NAC transcription factor ONAC010-like
SwissprotA2YMR07e-63NAC10_ORYSI; NAC transcription factor ONAC010
TrEMBLA0A0D2RV760.0A0A0D2RV76_GOSRA; Uncharacterized protein
TrEMBLW6JF180.0W6JF18_GOSHI; NAC domain protein NAC76
STRINGGorai.006G127700.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1887468
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.12e-52NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]