PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G120900.1
Common NameB456_006G120900, LOC105799311
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 196aa    MW: 21294.2 Da    PI: 5.7612
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G120900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.45.2e-43411401100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+
  Gorai.006G120900.1  41 PCAACKILRRRCADKCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPETQRADAVSSMVYEASARIRDPVYGCAGAICQLQKQINELQ 131
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         a+la++k++
  Gorai.006G120900.1 132 AQLAKAKAQ 140
                         *****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.91740141IPR004883Lateral organ boundaries, LOB
PfamPF031956.5E-4341138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MFKMEYSEST PTTTTATTSS NSPSSSSPPP PPPPPAVVIS PCAACKILRR RCADKCVLAP  60
YFPPTDPAKF TIAHRVFGAS NIIKFLQELP ETQRADAVSS MVYEASARIR DPVYGCAGAI  120
CQLQKQINEL QAQLAKAKAQ AEVANMQLQQ ANLAAFLCME MAETTSAQPN SHQFVDNPSF  180
MEDNNFGSFW EPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6169071e-124JX616907.1 Gossypium hirsutum clone NBRI_GE61864 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485250.11e-143PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR09e-74LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0D2NQY41e-143A0A0D2NQY4_G
STRINGPOPTR_0008s04350.13e-89(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-61LOB domain-containing protein 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]