PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G113700.1
Common NameB456_006G113700, LOC105799239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 372aa    MW: 41637.2 Da    PI: 8.4629
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G113700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.51.3e-49201461128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                         + pGfrF+Ptd el+++yLkkk++g +  + evi+e++i+++ePwdLp k++ ++++ew+fF+ r +ky++g++++rat++gyWkatgk++
  Gorai.006G113700.1  20 MFPGFRFSPTDVELISYYLKKKLDGYDKCV-EVIPEIEICRYEPWDLPvKSIIKSDNEWFFFCARGRKYPNGSQSRRATEQGYWKATGKER 109
                         579***********************9777.99***************777777899********************************** PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +v+s +++++g+k+tLvf++grapkge+t+W+mhey +
  Gorai.006G113700.1 110 NVKS-GSNVIGTKRTLVFHTGRAPKGERTEWIMHEYCM 146
                         ****.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-5511161IPR003441NAC domain
PROSITE profilePS5100552.09520162IPR003441NAC domain
PfamPF023653.6E-2522145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MMAGEGVSRE TQMSIQASSM FPGFRFSPTD VELISYYLKK KLDGYDKCVE VIPEIEICRY  60
EPWDLPVKSI IKSDNEWFFF CARGRKYPNG SQSRRATEQG YWKATGKERN VKSGSNVIGT  120
KRTLVFHTGR APKGERTEWI MHEYCMKGKS QDSLVVCRLR KNSEFRLNNN SNRVARNHRE  180
LSIVHDSNHA TSDGGTDLTG ISEGDKAIEF YSKKATSSND SHSIEQIDSA SESEQKLSNE  240
VAPTESSTLK KDSDDEEDFF AEILKDDIIR LDEASLSAST PEVLPMIATT THRVSLLQGG  300
ANRRIRLTRT KADIIQHGIG GISTKKWKSE EPPKCLLSVF SPRTAILVIL ITLLALLLPC  360
SNFKSSKVIQ I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-41111612164NO APICAL MERISTEM PROTEIN
1ut4_B2e-41111612164NO APICAL MERISTEM PROTEIN
1ut7_A2e-41111612164NO APICAL MERISTEM PROTEIN
1ut7_B2e-41111612164NO APICAL MERISTEM PROTEIN
4dul_A2e-41111612164NAC domain-containing protein 19
4dul_B2e-41111612164NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in plant cell division. {ECO:0000269|PubMed:16803883}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472350.0KC847235.1 Gossypium hirsutum NAC domain protein NAC58 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313716.10.0NAC domain-containing protein 89-like
RefseqXP_012485135.10.0PREDICTED: NAC domain-containing protein 89
SwissprotQ94F581e-104NAC89_ARATH; NAC domain-containing protein 89
TrEMBLA0A0D2S1300.0A0A0D2S130_GOSRA; Uncharacterized protein
TrEMBLW6JAQ00.0W6JAQ0_GOSHI; NAC domain protein NAC58
STRINGGorai.006G113700.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43092356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.11e-97NAC domain containing protein 89
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]