PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G113000.1
Common NameB456_006G113000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 229aa    MW: 25888.1 Da    PI: 6.5199
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G113000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.87.1e-4341352128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdi.ykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                         + GfrF Pt+eelv++yL+++++g + +++ vi+ ++i y++ePwdLpk     +k++ ++w++F++r++++a+g r++r+t+sgyWkatg
  Gorai.006G113000.1   4 AIGFRFFPTEEELVSFYLRNQLQGMRQDMHLVIPVLNIfYDLEPWDLPKlageLCKGDVEQWFYFTPRQEREARGGRASRTTASGYWKATG 94 
                         68***************************889****873678******656765566888******************************* PP

                 NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +   v+s++++++g+kkt+vfykg+ap+g+kt+W m+eyr+
  Gorai.006G113000.1  95 SPGFVYSSDDRVIGMKKTMVFYKGKAPNGRKTKWKMNEYRA 135
                         ***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-452161IPR003441NAC domain
PROSITE profilePS5100544.9653162IPR003441NAC domain
PfamPF023651.6E-225134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MEMAIGFRFF PTEEELVSFY LRNQLQGMRQ DMHLVIPVLN IFYDLEPWDL PKLAGELCKG  60
DVEQWFYFTP RQEREARGGR ASRTTASGYW KATGSPGFVY SSDDRVIGMK KTMVFYKGKA  120
PNGRKTKWKM NEYRAIEALS DPYVSAPPKL RHEFSLCRVY VASSSSRAFD RRPLEAHNNA  180
ATTSGGASGT SHAGGDHYNP AEASEDEFWE LVNNLEEHAI GWGQINEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-30116715170NO APICAL MERISTEM PROTEIN
1ut4_B2e-30116715170NO APICAL MERISTEM PROTEIN
1ut7_A2e-30116715170NO APICAL MERISTEM PROTEIN
1ut7_B2e-30116715170NO APICAL MERISTEM PROTEIN
4dul_A2e-30116715170NAC domain-containing protein 19
4dul_B2e-30116715170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ1300420.0KJ130042.1 Gossypium barbadense NAC protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485123.11e-173PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR37e-85NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A0D2SVQ01e-171A0A0D2SVQ0_GOSRA; Uncharacterized protein
STRINGGorai.006G113000.11e-172(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14452893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.22e-86NAC domain containing protein 61
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]