PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G088400.1
Common NameB456_006G088400, LOC105797898
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 314aa    MW: 36024.7 Da    PI: 6.6685
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G088400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.21.1e-51111391128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+ +yL++k++ ++++l ++i++v+iyk++Pw+Lp k+  +e+ew+fFs+rd+ky++g+r+nrat  gyWkatg+dk+
  Gorai.006G088400.1  11 LPPGFRFHPTDEELIIYYLNQKLSPSSNPLINIIADVNIYKFDPWELPGKALFGENEWFFFSPRDRKYPNGTRPNRATGCGYWKATGTDKP 101
                         79****************************999***************8777899************************************ PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++ +++  g+kktLvfykgr pk+++tdWvm eyrl
  Gorai.006G088400.1 102 IITSvGSQCLGMKKTLVFYKGRPPKASRTDWVMTEYRL 139
                         *99978888***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-608166IPR003441NAC domain
PROSITE profilePS5100558.5411166IPR003441NAC domain
PfamPF023651.4E-2612139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MYGMNSGSDI LPPGFRFHPT DEELIIYYLN QKLSPSSNPL INIIADVNIY KFDPWELPGK  60
ALFGENEWFF FSPRDRKYPN GTRPNRATGC GYWKATGTDK PIITSVGSQC LGMKKTLVFY  120
KGRPPKASRT DWVMTEYRLL YDHFLPQKPK GSMRLDDWVL CRVHHKIKVP QQITSGRNYD  180
RSSSCSPPFQ RGCLQGQEMI LNNYTIQQGN EYHQFPSHNY HMTIPLENEQ LDNQMECDGT  240
ITIDFNVRDM LEYIDHRVFH GGDIALGQEL PLVSEKRLNA SVSMHDDDNA YVPQICSQAP  300
SSSSSFREVF LEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-631117217171NO APICAL MERISTEM PROTEIN
1ut4_B3e-631117217171NO APICAL MERISTEM PROTEIN
1ut7_A3e-631117217171NO APICAL MERISTEM PROTEIN
1ut7_B3e-631117217171NO APICAL MERISTEM PROTEIN
4dul_A3e-631117217171NAC domain-containing protein 19
4dul_B3e-631117217171NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472420.0KC847242.1 Gossypium hirsutum NAC domain protein NAC65 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313731.10.0NAC transcription factor 56-like
RefseqXP_012483232.10.0PREDICTED: NAC transcription factor 25-like
SwissprotK4BNG76e-70NAP2_SOLLC; NAC domain-containing protein 2
TrEMBLA0A0D2RZF60.0A0A0D2RZF6_GOSRA; Uncharacterized protein
TrEMBLW6J8Z70.0W6J8Z7_GOSHI; NAC domain protein NAC65
STRINGGorai.006G088400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2501034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.18e-70NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]