PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G060900.1
Common NameB456_006G060900, LOC105797862
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 325aa    MW: 36222.9 Da    PI: 8.2964
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G060900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1813e-5641311129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL +kv++ +++  ++i +vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke
  Gorai.006G060900.1   4 LPPGFRFHPTDEELITYYLSHKVSDITFTS-KAIVDVDLNKCEPWDLPAKASMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKTTGKDKE 93 
                         79*************************999.88***************999999************************************* PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +++++g lvg+kktLvfykgrapkgek++Wvmheyrle
  Gorai.006G060900.1  94 IFRAGGVLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 131
                         ************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.19E-632151IPR003441NAC domain
PROSITE profilePS5100560.2874151IPR003441NAC domain
PfamPF023656.8E-295130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MENLPPGFRF HPTDEELITY YLSHKVSDIT FTSKAIVDVD LNKCEPWDLP AKASMGEKEW  60
YFFSLRDRKY PTGLRTNRAT EAGYWKTTGK DKEIFRAGGV LVGMKKTLVF YKGRAPKGEK  120
SNWVMHEYRL ENKHPFKASK EEWVVCRVFQ KSAAVKKPQP SSSSQPSLGS PCDANSIVNE  180
FGDVELPNLN INANPSCGFN DIATPSYSNT VNHGHMNAMN LNLDFGAASL PSSLSWPSSI  240
LSPNLSMNSF LFKALQLRNY QPRDVSGMDY SILSSTQGIN IPPFGTDLAS NFQGAVASSS  300
KVVVPMPQQQ QQQQEQPFNM DSLW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-54315716171NO APICAL MERISTEM PROTEIN
1ut4_B2e-54315716171NO APICAL MERISTEM PROTEIN
1ut7_A2e-54315716171NO APICAL MERISTEM PROTEIN
1ut7_B2e-54315716171NO APICAL MERISTEM PROTEIN
3swm_A3e-54315719174NAC domain-containing protein 19
3swm_B3e-54315719174NAC domain-containing protein 19
3swm_C3e-54315719174NAC domain-containing protein 19
3swm_D3e-54315719174NAC domain-containing protein 19
3swp_A3e-54315719174NAC domain-containing protein 19
3swp_B3e-54315719174NAC domain-containing protein 19
3swp_C3e-54315719174NAC domain-containing protein 19
3swp_D3e-54315719174NAC domain-containing protein 19
4dul_A2e-54315716171NAC domain-containing protein 19
4dul_B2e-54315716171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472230.0KC847223.1 Gossypium hirsutum NAC domain protein NAC46 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313723.10.0NAC domain-containing protein 100-like
RefseqXP_012483213.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ21e-81NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0D2NMH80.0A0A0D2NMH8_GOSRA; Uncharacterized protein
TrEMBLW6JEZ80.0W6JEZ8_GOSHI; NAC domain protein NAC46
STRINGGorai.006G060900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55272649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-113NAC domain containing protein 58
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]