PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G054800.2
Common NameB456_006G054800, LOC105798613
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 229aa    MW: 25888.2 Da    PI: 9.3435
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G054800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.51.1e-19150184135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C++Cg+ kTp+WR gp g+ktLCnaCG++y++ +l
  Gorai.006G054800.2 150 CQHCGAEKTPQWRAGPLGPKTLCNACGVRYKSGRL 184
                         *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.2E-15144194IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.532144180IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.65E-15146207No hitNo description
Gene3DG3DSA:3.30.50.106.8E-15148182IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.33E-14149197No hitNo description
PfamPF003203.1E-17150184IPR000679Zinc finger, GATA-type
PROSITE patternPS003440150175IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MEAFDMAACF EDNLLDFASD VGEEDEDKEH NKKSSTSSSS LNPNNSCFSE FAEEELEWLS  60
NKDAFPAVET SFVDVLGTAT KHQSSLTLTN GNVVMYCFGN VKIPVKARSK RLRKCRDLRD  120
HEKNWWVHEN VKTSNATAKG NRWRTMGRKC QHCGAEKTPQ WRAGPLGPKT LCNACGVRYK  180
SGRLVPEYRP ASSPTFSSKL HSNSHRKILE MRRHKQLGFP SMKPMDKR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012484192.11e-172PREDICTED: GATA transcription factor 1-like isoform X1
RefseqXP_012484193.11e-172PREDICTED: GATA transcription factor 1-like isoform X2
SwissprotQ8LAU95e-46GATA1_ARATH; GATA transcription factor 1
TrEMBLA0A0D2RQQ51e-172A0A0D2RQQ5_G
TrEMBLA0A0D2SSG71e-172A0A0D2SSG7_G
STRINGPOPTR_0003s17340.14e-74(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.14e-47GATA transcription factor 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]