PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G033100.2
Common NameB456_006G033100, LOC105797835
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 161aa    MW: 17780 Da    PI: 5.2177
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G033100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.42.4e-43101091100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++p+ +reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l+
  Gorai.006G033100.2  10 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVPTFQREDAVNSLAYEAEARLKDPVYGCVGAISVLQRQVITLQ 100
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          el++++++
  Gorai.006G033100.2 101 RELDATNAN 109
                         ***998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.1069110IPR004883Lateral organ boundaries, LOB
PfamPF031953.7E-4310107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MSSSSYSSSP CAACKFLRRK CMPDCIFAPY FPPEEPQKFA NVHKIFGASN VSKLLNEVPT  60
FQREDAVNSL AYEAEARLKD PVYGCVGAIS VLQRQVITLQ RELDATNANL FRYAYNEMPP  120
LRPPQPPPPS AAGQSSGFCY PYQWNDPSDE DNERSSGGNM *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012483194.11e-116PREDICTED: LOB domain-containing protein 25
RefseqXP_012483195.11e-116PREDICTED: LOB domain-containing protein 25
SwissprotQ8L8Q32e-65LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A0D2SRF01e-116A0A0D2SRF0_G
STRINGPOPTR_0001s35280.12e-77(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.15e-64LOB domain-containing protein 25
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]