PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G017700.1
Common NameB456_006G017700, LOC105798194
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 387aa    MW: 43363.9 Da    PI: 7.6967
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G017700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.62e-52141411128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         + pGfrFhPtdeelv +yLkkk+++++l++ e ik++diyk+ePwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++
  Gorai.006G017700.1  14 MLPGFRFHPTDEELVGFYLKKKIQQRPLPI-ELIKQLDIYKYEPWDLPKLAASGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRP 103
                         579***************************.89***************8888899************************************ PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s+ +++ +glkk+Lvfy+gra kg ktdW+mhe+rl
  Gorai.006G017700.1 104 IYSSdGTKCIGLKKSLVFYRGRAAKGMKTDWMMHEFRL 141
                         ***956667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-5713173IPR003441NAC domain
PROSITE profilePS5100557.02814173IPR003441NAC domain
PfamPF023651.4E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MDEKNDVDKV DDVMLPGFRF HPTDEELVGF YLKKKIQQRP LPIELIKQLD IYKYEPWDLP  60
KLAASGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSDGT KCIGLKKSLV  120
FYRGRAAKGM KTDWMMHEFR LPSMSDSIPP SKKLFDKTLP ANDAWAICRI FKKTSTMAQR  180
ALSHTWISSL NHGAACSQLS SENISCTTEI GSTIPLCSNG ELQQDCSAGF SALDILSYKS  240
FHQTVYRPSP FHVSNGDLHN NMMFSQLDNM SGSSPKCTID TSSMLLSPPL ISNASASTDF  300
RGQQHQYGNF SISSPQDMQG NGGGAESEEG TRKTSDSIPD YNHLSMGFPF RLSPNMPDSW  360
KPNLPWDSPQ CPSEMSTTYS TDKCYT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-521617619168NO APICAL MERISTEM PROTEIN
1ut4_B5e-521617619168NO APICAL MERISTEM PROTEIN
1ut7_A5e-521617619168NO APICAL MERISTEM PROTEIN
1ut7_B5e-521617619168NO APICAL MERISTEM PROTEIN
4dul_A5e-521617619168NAC domain-containing protein 19
4dul_B5e-521617619168NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed at globular stage onward in the COL progenitors after the first division of the hypophyseal cell. Later observed in these cells and their descendants, mostly in direct daughter cells. Also detected in the Epi/LRC stem cells and daughters, and is retained in maturing LRC layers. Present in elongated stem cells that are about to divide. {ECO:0000269|PubMed:19081078}.
UniprotTISSUE SPECIFICITY: Expressed in root cap stem cells and their immediate daughters. {ECO:0000269|PubMed:19081078}.
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472030.0KC847203.1 Gossypium hirsutum NAC domain protein NAC26 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012483628.10.0PREDICTED: protein FEZ
SwissprotQ9ZVH01e-103FEZ_ARATH; Protein FEZ
TrEMBLA0A0D2Q1Y20.0A0A0D2Q1Y2_GOSRA; Uncharacterized protein
TrEMBLW6JEY30.0W6JEY3_GOSHI; NAC domain protein NAC26
STRINGGorai.006G017700.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-101NAC family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]