PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G257800.1
Common NameB456_005G257800, LOC105795442
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 282aa    MW: 32687.4 Da    PI: 8.5418
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G257800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.51.6e-46181443128
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                         pGfrFhPt+eel+ +yLk+ + +kkl+  ++i   +iy+++PwdLp   k +e+ewyf+++rd+k+ +g r+nr+t++g+Wkatg+d++++
  Gorai.005G257800.1  18 PGFRFHPTEEELLEFYLKNMIYDKKLRY-DIIGYHNIYHHDPWDLPGLSKIGEREWYFYVPRDRKHGSGGRPNRTTANGFWKATGSDRKIV 107
                         9**************************9.99***************8778899*************************************9 PP

                 NAM  94 sk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         s    ++ +glkktLvfykgrap+g ktdWvm+eyrl
  Gorai.005G257800.1 108 SLsdPKRIIGLKKTLVFYKGRAPRGCKTDWVMNEYRL 144
                         97666778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.81516162IPR003441NAC domain
SuperFamilySSF1019411.16E-5517162IPR003441NAC domain
PfamPF023652.4E-2418144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MSSQSSMDDN ATPKIELPGF RFHPTEEELL EFYLKNMIYD KKLRYDIIGY HNIYHHDPWD  60
LPGLSKIGER EWYFYVPRDR KHGSGGRPNR TTANGFWKAT GSDRKIVSLS DPKRIIGLKK  120
TLVFYKGRAP RGCKTDWVMN EYRLPDGCSL PKDVVLCKVY RKATSLKVLE QRAAMEEELK  180
AIKNTSRSSP LSSMETISFC SPKEAQVPAP QMFCKKENEE EQEQETMVEK NRCLQLPLGS  240
EKLPELQMPK VLSDWTQDQF WTQLNSPWFQ NLTTYANILN F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-451816217168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8471970.0KC847197.1 Gossypium hirsutum NAC domain protein NAC20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313931.10.0NAC transcription factor 29-like
RefseqXP_012480516.10.0PREDICTED: NAC transcription factor 29-like
SwissprotQ10S651e-94NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A0D2RTA90.0A0A0D2RTA9_GOSRA; Uncharacterized protein
TrEMBLW6J8W20.0W6J8W2_GOSHI; NAC domain protein NAC20
STRINGGorai.005G257800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38992860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-117NAC domain containing protein 36
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]