PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G254200.1
Common NameB456_005G254200, LOC105795405
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 267aa    MW: 28676.9 Da    PI: 6.6613
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G254200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.18.1e-0888134551
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                         k  +r   NReA r++R++ ka+ + Le++v  L a N++L k+l+ 
  Gorai.005G254200.1  88 KSKKRPLGNREAVRKYREKVKARAASLEDEVMRLRAVNQQLLKRLQG 134
                         77889999**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-784151IPR004827Basic-leucine zipper domain
PfamPF077161.1E-1385141IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-1286152No hitNo description
PROSITE profilePS502178.50886133IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.01E-588134No hitNo description
CDDcd146862.39E-1090143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MDDGELDFSN QEVFSGNNMG DIPSSCSMDS FFDELLNDSH ACTHTHTCNP PGPDNSHTHT  60
CFHVHTKIVP ASTEDKASID DTAGSREKSK KRPLGNREAV RKYREKVKAR AASLEDEVMR  120
LRAVNQQLLK RLQGQAALEA EVARLKCLLV DIRGRIEGEI GSFPYQKSAT AVNGMNMPGA  180
YVMNPCHVQC NDQMYCLHPG VEGRTGEDAA LHGQGFNGCD FDNVQCLADY NSGAKELSTG  240
GVGSGGSNGN SSGTKRRKGV RPATAG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480469.10.0PREDICTED: uncharacterized protein LOC105795405
SwissprotQ8GTS21e-114BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0D2SNA50.0A0A0D2SNA5_G
STRINGVIT_03s0038g02420.t011e-141(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-111bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]