PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G248900.3
Common NameB456_005G248900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 484aa    MW: 52077.4 Da    PI: 6.2497
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G248900.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.97.1e-11414462553
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                         kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+
  Gorai.005G248900.3 414 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQ 462
                         9*****************************************9998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-12410472IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.197412464IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.0E-11414470No hitNo description
Gene3DG3DSA:1.20.5.1702.6E-11414464No hitNo description
PfamPF001701.1E-9414461IPR004827Basic-leucine zipper domain
CDDcd147036.53E-26415464No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MGDSEEGNTD LMQRIQSSFG TSSSSIPKQV LSMNHLEIPP LNPNQIRAVR HFSHFGQNFN  60
GGGGGGGGGG DGNKRVGIPP SHPNQIPPIS PYSQIPVSRP SSHQMGSSQG FSPGPTHSRS  120
LSQPSSFFSF DSLPPLSPAP VTQISNDVCM EDSHSLLPPS PFPKASSPRV GESLPPRKSH  180
RRSNSDIPFG FNTVMQSSPP PLRGSGFENS GVPRPVQLVK KETSWERGID GNVEGMGERK  240
SEGEVMDDLF SAYMNLDNID ALNSSEDKNN NNENHEDLDS RASGTKTNGG DSSDNEAESS  300
VNESGNSVTQ GGVYSTQKRE GNKRSAGGDI APTSRHYRSV SMDSFMGKLN FGDESPKLPP  360
SPGSRPGQLS PSNSIDGNSA AFSLELGNGE FNEAELKKIM ANEKLAEIAM TDPKRAKRIL  420
ANRQSAARSK ERKMRYISEL EHKVQTLQTE ATTLSAQLTL LQVEDLELFN VIGYIPYFPV  480
SHP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480420.10.0PREDICTED: transcription factor RF2a
RefseqXP_012480421.10.0PREDICTED: transcription factor RF2a
TrEMBLA0A0D2SN430.0A0A0D2SN43_G
STRINGPOPTR_0009s12830.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-104bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]